KEGG   Drosophila erecta: Dere_GG10205Help
Entry
Dere_GG10205      CDS       T01060                                 

Definition
GG10205 gene product from transcript GG10205-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dere_GG10205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKTKTSAVQDDIAEYKDFKKLLRTKNNVLALYITSAKAAAAEL
KVFREAAEAVRGTGTMLLLDCGQQDRKKLCKKLKVSPEPYAIKHYKDGDFHKDYDRQLTV
SSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKAATELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKDALISFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFTNGVFKFE
VNVREASKIVEFMRNPKEPPPPPPPEKSWEEEEDSKEVIFLDDDNFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTIMYFSYLK
TKLDYNGGRTSKDFIAYMNNPPSSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaccggtcagtttgtttttctactgctggtggcacttgttgccgcaaaaacg
aaaacttcggctgtgcaggatgacatcgcggagtataaggacttcaagaagctgctgcgc
accaagaacaatgtccttgcgctctatataaccagtgcgaaggctgctgctgccgagcta
aaggtattccgggaggcggcggaggcggtacgtggaactgggacgatgttgctgctggat
tgcggccagcaggatcgcaagaaactttgcaagaagctgaaggtctcgccagagccttac
gccattaagcactacaaggatggcgacttccacaaggactatgaccggcagctgactgtc
agctccatgatcactttcatgcgtgatccctctggcgatttgccctgggaggaagatcca
gccggcaaagatgtcctgcactttagcgacgccgcttccttcacaaaacacctacgcaag
gacatccggcccatgcttgtcatgttctatgttccctggtgcggcttctgcaagaaaatg
aagccggattacggaaaagcggccacggagctgaagaccaagggcgggtatattctggcg
gcaatgaatgtggagcgacaagaaaacgctcctatacgcaaaatgttcaacataacaggt
tttcccaccctgatttattttgaaaatggcaaactgcgctttacttacgagggagagaac
aataaggatgctttaatatctttcatgctcaacccaaatgctaagccaacgccaaagccc
aaggaaccagaatggtcggcggacaccaactcggaaattgttcatctcacgtcgcagggt
tttgagcctgctctgaaggacgagaagtccgccttggtcatgttctatgcgccctggtgc
ggacactgtaagcgcatgaagcctgaatacgaaaaggcagctctggaaatgaagcagaaa
aagattcccggacttttggccgcattggatgcaacgaaggagccgtcaatcgcagagaaa
tacaaagtcaagggctatccaactgttaagtttttcacgaatggcgtctttaagtttgaa
gtaaatgtacgcgaagcatcgaaaattgtcgaatttatgcgaaatcccaaggagcctcca
ccgcctccgccgcccgagaagagttgggaggaggaggaagacagcaaagaagttatattt
ctggatgatgacaacttcagttcgacgctgaagagaaaaaagcatgcgctagttatgttc
tatgctccctggtgtggacactgtaagcacacaaaacctgagtttacagcggctgccacg
gccttacaggatgatcctcggatagcgtttgttgccatcgactgcacaaagcttgccgca
ctctgcgcaaagtacaatgttcgcggatatcccaccattatgtacttctcttacctcaaa
accaagctggattacaacggcggacgcaccagcaaggactttatcgcctatatgaacaat
ccgccgagctcagcggaccgtacagagctgtga

DBGET integrated database retrieval system