KEGG   Drosophila erecta: Dere_GG10205Help
Entry
Dere_GG10205      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dere_GG10205
Chaperones and folding catalysts [BR:der03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dere_GG10205
Membrane trafficking [BR:der04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dere_GG10205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_8 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 6541967
NCBI-ProteinID: XP_001969630
FlyBase: FBgn0102515
UniProt: B3NAX5
Position
Unknown
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKTKTSAVQDDIAEYKDFKKLLRTKNNVLALYITSAKAAAAEL
KVFREAAEAVRGTGTMLLLDCGQQDRKKLCKKLKVSPEPYAIKHYKDGDFHKDYDRQLTV
SSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKAATELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKDALISFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFTNGVFKFE
VNVREASKIVEFMRNPKEPPPPPPPEKSWEEEEDSKEVIFLDDDNFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTIMYFSYLK
TKLDYNGGRTSKDFIAYMNNPPSSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaccggtcagtttgtttttctactgctggtggcacttgttgccgcaaaaacg
aaaacttcggctgtgcaggatgacatcgcggagtataaggacttcaagaagctgctgcgc
accaagaacaatgtccttgcgctctatataaccagtgcgaaggctgctgctgccgagcta
aaggtattccgggaggcggcggaggcggtacgtggaactgggacgatgttgctgctggat
tgcggccagcaggatcgcaagaaactttgcaagaagctgaaggtctcgccagagccttac
gccattaagcactacaaggatggcgacttccacaaggactatgaccggcagctgactgtc
agctccatgatcactttcatgcgtgatccctctggcgatttgccctgggaggaagatcca
gccggcaaagatgtcctgcactttagcgacgccgcttccttcacaaaacacctacgcaag
gacatccggcccatgcttgtcatgttctatgttccctggtgcggcttctgcaagaaaatg
aagccggattacggaaaagcggccacggagctgaagaccaagggcgggtatattctggcg
gcaatgaatgtggagcgacaagaaaacgctcctatacgcaaaatgttcaacataacaggt
tttcccaccctgatttattttgaaaatggcaaactgcgctttacttacgagggagagaac
aataaggatgctttaatatctttcatgctcaacccaaatgctaagccaacgccaaagccc
aaggaaccagaatggtcggcggacaccaactcggaaattgttcatctcacgtcgcagggt
tttgagcctgctctgaaggacgagaagtccgccttggtcatgttctatgcgccctggtgc
ggacactgtaagcgcatgaagcctgaatacgaaaaggcagctctggaaatgaagcagaaa
aagattcccggacttttggccgcattggatgcaacgaaggagccgtcaatcgcagagaaa
tacaaagtcaagggctatccaactgttaagtttttcacgaatggcgtctttaagtttgaa
gtaaatgtacgcgaagcatcgaaaattgtcgaatttatgcgaaatcccaaggagcctcca
ccgcctccgccgcccgagaagagttgggaggaggaggaagacagcaaagaagttatattt
ctggatgatgacaacttcagttcgacgctgaagagaaaaaagcatgcgctagttatgttc
tatgctccctggtgtggacactgtaagcacacaaaacctgagtttacagcggctgccacg
gccttacaggatgatcctcggatagcgtttgttgccatcgactgcacaaagcttgccgca
ctctgcgcaaagtacaatgttcgcggatatcccaccattatgtacttctcttacctcaaa
accaagctggattacaacggcggacgcaccagcaaggactttatcgcctatatgaacaat
ccgccgagctcagcggaccgtacagagctgtga

DBGET integrated database retrieval system