KEGG   Drosophila erecta: Dere_GG10405Help
Entry
Dere_GG10405      CDS       T01060                                 

Definition
GG10405 gene product from transcript GG10405-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dere_GG10405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 679 aa AA seqDB search
MASEQTIDGAAAIPSGGGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPEVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIDGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCKADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccgcaatccccagcggcggcggcgacgaa
cccttcctgggcctgctggacgtggccctactggcggtgctcatcggcggagcagccttc
tacttcctgcgcagccgcaagaaggaggaggagccaaccaggagctattccatacaaccc
accacagtgtgcaccaccagtgcgtcggacaactcgttcatcaagaagctcaaggcatcc
ggacgcagtctggtcgttttctatggctcgcagaccggaaccggcgaggagttcgccggc
cgtctcgccaaggagggcattcgttaccggctgaaaggcatggttgccgatcccgaggag
tgcgacatggaggagctgctgcagctgaaggacatcgacaactccttggcggtcttctgc
ctggccacctacggcgaaggagatcccactgacaacgccatggagttctacgagtggatc
accagcggcgatgtcgacctaaccgggctaaattatgcggtctttggcttgggaaacaag
acctacgagcactacaacaaggtggccatctatgtggacaagcggctggaggagctgggc
gccaaccgggtctttgaactgggactgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggaccgcttctggcccgctgtgtgcgaccactttggcatcgagggcggc
ggcgaggaagtgctcatccgtcagtaccgtctgctggaacagccagaggtacagcccgac
cgcatatacacgggagagatcgcgcgcctgcactcgattcagaaccagcgtccgcccttc
gacgccaagaaccccttcctggcacccattaaggtgaaccgcgagctgcacaagggcggc
ggtcgctcctgcatgcacatagagctgagcatcgatggatccaagatgcgctacgacgcc
ggggaccatgtggccatgttccctgtcaacgacaagagtctggtggagaaactcggccag
ctgtgcaaagccgatctggatactgtgttctcgctgatcaacacggatacggacagcagc
aagaagcacccattcccttgccccaccacgtaccgcacggctctgacccactatttggaa
attacggctattccccgcacgcacatcctgaaggagctcgctgagtattgtactgacgag
aaggagaaggagttgctgcgcagcatggcctccatcagtcccgaaggaaaggagaagtac
cagagctggattcaagacgcatgtcgcaacattgtccacattctggaagacatcaaatcg
tgtcgcccacccatcgatcacgtttgcgaactgctgccccgcttgcagccgcgttactac
tccatctcgtcgtctgctaagctgcaccctactgatgtccacgtgacagccgttctcgtg
gagtacaagactccgacagggcgcatcaacaagggcgtggccaccacatatctgaagaac
aagcaaccgcaaggcagtgaggaagtaaaggtgccggtattcatccgcaagtcgcagttc
cgtttgcctacgaagccagagacgcctatcataatggtgggtcccggcaccggcctggcc
cctttccgcggcttcattcaggagcgacagttcctgcgcgatgagggcaagaccgttggc
gagtcgattctctacttcggctgccgtaagcgcagcgaggactacatctacgaatccgag
ttggaggagtgggttaagaagggcactctcaaccttaaggccgccttttcccgtgaccag
ggcaagaaggtctatgtacagcacctgcttgaacaggacgcggatcttatatggaacgtg
attggcgagaataaggggcacttctacatatgcggtgatgcgaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccactaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgacgtctggagctaa

DBGET integrated database retrieval system