KEGG   Drosophila erecta: Dere_GG10480Help
Entry
Dere_GG10480      CDS       T01060                                 

Definition
GG10480 gene product from transcript GG10480-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dere_GG10480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG10480
   00020 Citrate cycle (TCA cycle)
    Dere_GG10480
   00620 Pyruvate metabolism
    Dere_GG10480
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dere_GG10480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 494 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSAGNVVVRALSCQLINSRNLQSIRSKLTTS
QSPIAWSYNFARAYSNLPDHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAGAPPPAP
AAAPAPAAAPAAAPPPPPAAAPVAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQLRL
QGQKAAAKPAAAAPAKAPRAAGARYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVD
KLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLKVPEANSAWMDTVIRKYDDVDVSVA
VSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFGVN
QFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARWLQ
HFRDYMEDPSNMVL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaactcggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcggccggaaatgtggtggtgcgcgccctc
agctgccagctgatcaactcccggaatctccagagcatcaggtcaaaacttaccactagc
cagtcaccgatcgcatggagctacaacttcgcccgtgcctattccaaccttccggatcac
attagggtgccactgcctgctctttcccccaccatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagcttaacgaaggtgacctgctgtgcgagattgagacggac
aaggccaccatgggctttgagacgcccgaggagggctttctggccaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcataatcgtgcctgaccaaggt
agcgtagctgccttcgcgaacttcaaggacgacggtgccggcgcaccaccaccagctccg
gcagcagctccagcgcccgcagcagcaccagctgcagcaccgccaccaccacccgccgca
gctccagtagccgctgcgcccccaccagctcccgccgctgctccagctgcagcaggtaca
gggcgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctgcgtcta
caaggccagaaagcggcagccaagccagctgctgcagcacctgccaaggcccccagggca
gctggagcccgctacgaggacatcccggtgaccaacatgcgcgcagtgattgccaaacgc
ctgctggagtccaagacccaactgcctcactactacgtcaccgtgcagtgccaagtggat
aagctcctgaagttccgcgcgaaggttaacaagaagtacgagaagcagggtgcccgcgtc
tctgtgaacgacttcatcatcaaggccgtcgcgatcgccagtcttaaagttcccgaagcg
aactcggcctggatggacacagtaatccgaaagtatgacgacgttgatgtctcggtggcc
gtctccacagataagggtctgattacccccattgtcttcaatgccgaccgcaagggagtc
ctggagatctctaaggatgtcaaggcgctggcagccaaggcgcgtgacaacaaactgcag
ccccacgagttccagggcggcaccatctcggtgtctaatctgggcatgtttggtgtgaac
cagtttgccgctgttatcaaccctcctcaatcgtgcatccttgccattggcaccacaacg
aaacagttggttgcggatcctgacagcctcaagggtttcaaggaggtcaacatgctgacc
gtcaccctgagcgctgatcatcgtgttgtggatggtgctgttgctgccaggtggctgcag
cacttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system