KEGG   Drosophila erecta: Dere_GG10494Help
Entry
Dere_GG10494      CDS       T01060                                 

Definition
GG10494 gene product from transcript GG10494-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
der  Drosophila erecta
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dere_GG10494
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dere_GG10494
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dere_GG10494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MFATPLRQPAAANQRPKSSPGMEEHGKPYQYEITDHGYGKDAVKVLHVSRKGPVHTIQEF
EVGTHLKLYSKKDYYQGNNSDIVATDSQKNTVYLLAKKHGIESPEKFALLLARHFINKYS
HVEEAHVHVEAYPWQRVCQEETRTTLNGKCENGVQGNCDFSSVDNRSLHNHAFIFTPTAF
HYCDVVLRRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSW
EYSDTDNLDFLRAWQTVKNIIIRNFAGDPQVGVSSPSVQHTLYLSERQVLDVLPQVSVIS
MTMPNKHYFNFDTKPFQKIAPGDNNEVFIPVDKPHGTIYAQLARKHLNSHL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacgcccctcagacagccagctgcggccaaccagaggccaaagagttcccct
ggcatggaagaacatgggaaaccgtatcagtacgagattaccgatcacggatacggcaag
gatgcggtcaaggttctgcatgtcagtcgcaagggacctgtgcacaccatccaggagttc
gaggtgggcactcacctgaagctgtacagcaagaaggattactaccagggcaacaactcg
gacatcgtggccaccgattcgcagaagaacaccgtctatctgctggccaaaaagcacggc
atcgagagtcccgagaagtttgccctgctcctggccaggcacttcatcaacaagtactcg
cacgtggaggaggcgcacgtccatgtggaggcctatccctggcagcgagtatgccaggag
gagaccaggaccaccctcaatggaaagtgtgagaacggagtccaaggaaactgcgacttc
agctccgttgacaacagatcgctgcacaatcacgcttttattttcactcccaccgccttt
cactactgcgatgtggttttgaggagaacagatcccaaacaaacggtcatcacgggcatc
aaaggcctgcgagtgctgaagacgacccaatcctcgtttgtgaacttcgtgaatgacgag
ttcagatctctgccagatcagtatgatcgcatctttagcaccgtggtggattgctcctgg
gagtactccgacaccgacaacttggacttcctgagggcctggcagacggtcaagaatata
atcattcgtaacttcgctggcgatccgcaggtgggcgtgtcctcgccctccgtgcaacac
accctgtatctcagtgaacgacaggtcctggatgtcctgccgcaggtgtcggtcatttcg
atgaccatgccgaacaagcactacttcaacttcgatacgaagcccttccagaaaattgct
ccgggcgataataacgaagttttcatcccagtggacaagccacatggcaccatctatgcc
cagttggcccggaagcacctcaacagtcatctctag

DBGET integrated database retrieval system