KEGG   Drosophila erecta: Dere_GG10530Help
Entry
Dere_GG10530      CDS       T01060                                 

Definition
GG10530 gene product from transcript GG10530-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dere_GG10530
    1.3.1.94  polyprenol reductase
     Dere_GG10530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 326 aa AA seqDB search
MAVPENGILEVLENLLDRYKINLLQMMFGTFIATIVFFGGLMTFVEKYLPNSIRQSFRYG
KHSFKGETDPLVAWLEVPKSWFKHFYIFALFWSWLAFYILVSTVREQKEAPEYVLRFLDI
MGGGRSHRKVEIDSTTACVGALMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYF
GAVIALLSNTSGFVRGSKPLEFSLDKLTGQQILYLVVFFLAWQQQYASNMILVNLRKDPR
TGSVKTEKHLLPKGGLFNLLSSPHMFLEVVMYFCIADLYMPVRIWRLIFLWVASNQTINA
LLTHKWYRETFREYPKNRRAIIPFLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacccgaaaatgggatccttgaggtcctcgagaaccttctcgaccggtacaaa
atcaacctgctgcaaatgatgttcggcactttcattgcaacgatcgtgttctttggcgga
cttatgacctttgtggagaagtacctgcccaatagcatacggcagtcgtttcggtatgga
aagcacagcttcaagggtgaaacggatcctttggtggcctggttggaggttccgaaatcc
tggttcaagcatttctacatctttgccctcttttggagctggctggcattttacatcctc
gtttcaactgtacgggagcaaaaggaggcgccggaatatgtcctgcgattcctggacatc
atgggcggcggacggagtcaccggaaggtggagatcgactcaacaactgcctgtgtcggc
gcactcatgctcacgttgcagtgcacccggcgtttttacgagaccaactttgtgcagatc
ttctccaagaagagcaagatcaatctgtctcactatgccgtgggttatgtgcactacttt
ggcgccgtcatagcattactatccaatacctccggctttgtgcgcggctcgaagcccttg
gagttcagcctggacaagctgacaggccagcaaatactctaccttgtcgtcttctttctc
gcctggcagcagcagtatgccagcaacatgatattggtcaacctgcggaaggatccgcgg
acgggaagtgtaaaaacggaaaagcaccttctgcccaagggtggtcttttcaatctgctt
tcgtcgccacacatgttcctcgaggtggtcatgtacttttgcatagccgacctctacatg
ccagtaaggatttggcgactaatattcctctgggtggcaagcaatcaaacgatcaatgct
ctgctaacccacaagtggtaccgggaaacatttagggaatatccaaagaaccgacgtgct
attattccgttcctgctctga

DBGET integrated database retrieval system