KEGG   Drosophila erecta: Dere_GG10863Help
Entry
Dere_GG10863      CDS       T01060                                 

Definition
GG10863 gene product from transcript GG10863-RA
Orthology
K17499  
protein phosphatase 1G [EC:3.1.3.16]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 664 aa AA seqDB search
MGAYLSHPKTDKTSTDQFNDLLAVGASSMQGWRNSQEDAHNSILNFDNNTSFFAVYDGHG
GAEVAQYCADKLPEFLKNLESYKDGQFEVALKEAFLGFDKTLLNPSIVGILKILAGEHNF
IDAEAEDYEDEDLAELQEESNLPLNKVLEKYKGLPQRENLDFKNSDHKEHFEMHSSYFRG
RRAAALAAEATNKAVMDPSAKPDGSSTSAAAAAAALSADGVVNAHYPSNVVNPMVGTASN
NASSINNSSANNAALKDDFSNDQNEGSNGTDFKQTLVTSNNSKLFAIGSNDMTELHQSGT
SSKNEVTNSTTSEESEKNINSSQEDEFTDDDADYEENDIVKSPNTSSESSDCTENDDEGD
EDGNEDSDEEETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVI
SRSGQAIEMSIDHKPEDEEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVSLPA
EEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLQGNKKLSTICEEL
FDNCLAPNTMGDGTGCDNMTTVIVQFKKKLQELQSAIQPNQTEDKLLKTSDNVSDSIIEH
SAPKRCASPNVASEDAIHEINNSKRLKTELEPANTIGRSPSPNSQNENPGKKAIKEVTII
VSSS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctatttgtcccatccaaaaacggataaaacttccactgatcagtttaatgac
ttgctagccgttggagctagctctatgcagggatggcggaacagccaagaggatgcacat
aactctattttaaattttgacaacaatacatcgttttttgccgtgtatgatggacacggt
ggagctgaggtagcgcaatattgtgctgacaagttaccagaatttcttaaaaaccttgaa
tcctataaagatggacaatttgaagtggcactcaaggaagcatttctgggatttgacaaa
acactacttaatccatcaatagtcggtatactaaaaatattggctggagaacataacttc
attgatgctgaagcggaagattacgaagacgaagatttagctgaattgcaagaggaaagc
aatttgcccctaaataaagttttggaaaaatacaaaggacttccgcaaagagaaaatttg
gattttaagaattctgatcacaaagaacattttgaaatgcactcttcatattttcgcggg
cgccgagctgcagcgttagctgccgaagctactaataaagctgtaatggacccctctgca
aagccagatggttcttccacttccgcagcagcggctgcagctgcgctatccgccgatggt
gtagttaatgctcattatccgagcaatgtagtaaatcctatggttgggacggctagtaat
aacgctagcagtatcaacaattcatccgccaataacgctgctttaaaagatgatttcagt
aatgaccaaaatgagggatcgaatggaacagattttaagcaaacgttggtgacttctaat
aatagtaaattattcgcgattggttctaacgacatgaccgaattacatcaatctggaaca
tcctcgaaaaacgaggtcacaaactcaactaccagcgaagaatctgaaaagaatataaac
agctcccaagaggatgagttcacagacgatgatgcggactatgaagaaaatgacattgtc
aagagtcctaatacttcatccgaaagctctgactgcacagaaaatgatgatgagggtgac
gaagatggtaatgaggatagtgacgaagaagagactgatgaagatcagatggctaatgac
aatttttgcgcaaatatgattgaggaacctggaaaggatagtggatgcactgcagttgta
tgtttgttgcaaggtcgggacctttacgtggcaaacgcaggggattcgcgatgtgttatt
tcacgcagtgggcaggctattgaaatgagtatcgaccacaagcccgaagatgaggaagaa
gcctcgcgcataataaaggcaggaggtcgtgtcacacttgatggacgcgtaaatggtggc
ctcaatttgtctcgtgcccttggagaccatgcctataaaacgaatgtaagccttccagct
gaggaacaaatgatatctgccctacctgacatcaagaagctaattatcaccccagaggac
gagtttatggtactggcctgtgatggtatatggaattatatgtccagtgaggaagtcgta
gagtttgtacgttgcagattacaaggtaataagaaattgtcaacgatttgcgaagagctt
tttgataactgtttagctccgaatacaatgggtgatggaactggatgcgacaacatgact
actgtaatcgttcagtttaagaaaaagttgcaagagctacagtctgccattcaaccaaat
caaactgaagataagttacttaagacatctgataatgtttcagatagtataattgaacac
agtgcgcccaagagatgtgcgtcaccaaatgtggcttctgaagacgcaatacatgaaata
aacaactctaaacgattaaaaactgaactggaacctgcaaacactataggcagatcccca
tccccaaacagtcagaatgaaaaccctggcaagaaggccattaaggaagttactattatt
gtttcttcatcctaa

DBGET integrated database retrieval system