KEGG   Drosophila erecta: Dere_GG11218Help
Entry
Dere_GG11218      CDS       T01060                                 

Definition
(RefSeq) GG11218 gene product from transcript GG11218-RA (EC:3.2.1.45)
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dere_GG11218
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dere_GG11218
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG11218
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dere_GG11218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 584 aa AA seqDB search
MVLSGNYPLLVFKCQSGGRDRSERSVGNMFASRGVLVLVVLLVSAIGGQSESIPCKLKDE
KHGKVCVCTADYCDYLENPVLTDENEWFLISSSKQGLRFSTTSDKFGKQEKITVQDYVEA
TQVTANATILSRLLDQVVASAFTLESRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVE
YLVDNFKRSELADHLYKSFYAEDGLGFNLMRVPIGGCDFELEAWSYGEEDTSLSDMDELN
AHDVKRVAQIKRLIEVSGVKNLLVKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHL
RWLRLMKNNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDHLGPTIRNSE
FKDIILFGNDDQRYSFPHWFKMMNRTRPNSIDYLNGLSVHWYWDEIFGNSFIEQTTEYAP
DKLLIVSESCIGDKPWQSATPLLGSWERAEKYARDYLLNIRLGFHGWIDWNICLDEMGGP
NYVDNTVDAPVIVNTTTFEQFYKQPMFYAIGHFSKLVPEGSVRIDAVPSNINLDSVAFLR
PDNKIAAVLFNSGRADLDITLVDSIRGQFVVNVPAKSIHTLLYS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggtcttatcaggcaactacccgctcctcgtctttaagtgtcagtcaggtggcagagat
cggagtgaacggtctgtgggaaacatgttcgccagcagaggagtcctggtgctggtagtg
cttctggtatcggcaattggtggccaatcggagtcgattccatgcaagctcaaggatgaa
aagcatggcaaagtgtgcgtctgcacggcggactattgtgactatctggagaaccccgtc
ctgacggacgaaaatgagtggttcctgatctccagctccaagcagggactgcgattctcc
acaaccagtgataaattcggcaagcaggagaagattaccgtgcaggattatgtggaagcc
acccaggtgaccgcgaatgcaactatcctgtctcgtctgctcgaccaggtggtggccagt
gcctttaccttggagtcccgggagagttccataactcgcacggtgaccctgcgattggac
cgaagtaagacccaccagaagatggttggcttcggtggcagctacaccggagctgtggag
tatctggtggacaacttcaagcgttcggaactggccgaccatctgtacaagtccttttac
gccgaggacggactgggcttcaatctcatgcgagttcccattggcggctgtgactttgaa
ctggaggcctggtcatatggcgaggaggacacctcgctgtccgacatggatgaactgaat
gcgcatgatgtgaagcgagtggcgcagatcaagcgactcatcgaggtgtccggagtgaag
aatctgttggtcaaaggagccgcctggagttccccgccctggatgaagaccaacaaccgc
tggacaggatttggacgactcaagcgggcttactaccagacatgggccgattaccacctg
cgttggctgaggcttatgaagaacaatggcattcccatttgggccatttccacgggcaac
gagcccttgaacggcatcattttcatgtactttgttaagttcatgagcttgggatggacg
ccacagacccaggccatttggctgaacgatcatctgggtcccactatccgtaactctgaa
ttcaaggacatcatcctgtttggcaacgacgatcaacgctattcctttccccattggttc
aaaatgatgaatcgcactcgtccaaactcgattgattacctgaatggattatcggtgcac
tggtattgggatgaaatttttggcaacagcttcatcgaacagaccacggaatacgccccc
gacaagttactgattgtttccgagtcctgtatcggggataagccctggcagtcagctact
cctctgctgggaagctgggagcgggcggagaagtatgcccgggattacctgcttaacatt
aggctgggcttccatggctggatcgactggaacatttgtctggacgagatgggcgggccc
aactacgtggacaacacggtggatgcaccagtgattgtcaatactacaacattcgagcag
ttctacaagcagcccatgttctatgccattggtcacttctccaagttggttccggagggc
tcagttcgtatagatgccgtaccaagtaatattaatctggactctgttgcattcctgcga
ccggacaacaaaatcgccgccgttctcttcaatagtggacgtgccgatctggacatcact
ttggtggatagtattcggggtcagttcgtcgtcaatgttccggccaagtccattcacact
ttgctgtacagttga

DBGET integrated database retrieval system