KEGG   Drosophila erecta: Dere_GG11220Help
Entry
Dere_GG11220      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
der  Drosophila erecta
Pathway
der00511  Other glycan degradation
der00600  Sphingolipid metabolism
der01100  Metabolic pathways
der04142  Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dere_GG11220
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dere_GG11220
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG11220
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dere_GG11220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 6554168
NCBI-ProteinID: XP_001982110
FlyBase: FBgn0103521
UniProt: B3P8F6
Position
Unknown
AA seq 563 aa AA seqDB search
MKTPWLGFLFALVASSAGATDWQLPCDLRETSHGSVCVCNSTYCDYLEQPQLADPSQIVV
ISSSKDGLRFKKTTGDLSENKPITIDDKQFTDENFNADAILVDQERAWLQLANIPQSLFI
NASIRTYRISVKREQRFQNVSIFGGAFTGTVSYLLKELPAALQDHVYKSYFHPVGIAYNT
IRMSIGGSDFDMEPWAYNEWPRHDLKLSNFSELDPRDLQKVEQLKRLKAIGKVDELKIMG
AAWSAPTWMKSNERWTGFGQLKSEYYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNGV
IGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRNSTESKVLIFGNDDQRYTYPMWFRKMRSS
RSNSLSYLDGLAVHWYWDELIGPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSW
QRGESYMRAYTQDLAHNFNGWLDWNLVLDERGGPNYVNNFVDAPIIVNATSRAEIYKQPI
FYAIGHFSKFLPPESVRIETRIEKQGNPFTQISAVGFQRPDGSVALIIYNGQNQPVDVAL
DDSQRGAINLRLPPRSWHTVLYK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccttggcttggctttcttttcgcactggtggccagctcggcaggtgctacc
gactggcagctaccctgcgatttgcgcgaaacgagccatggcagcgtgtgcgtctgcaac
agcacctactgcgactacctggagcagccgcagcttgctgatccctcgcagattgtggtg
attagcagcagcaaggatggcctgcgcttcaagaagacgacgggggatctttcggagaac
aagcccattacaatcgacgacaaacagttcaccgacgagaacttcaacgcagatgcgatt
ctggtggatcaggagagagcctggttgcagttggccaacattccccagagcctgtttatt
aatgccagcattaggacatatcgcatatcggtgaaacgggagcagcgctttcaaaacgtc
tccatttttggcggcgccttcacgggaacagtctcgtacttgctcaaggaactaccggca
gcactacaggatcatgtctataaatcctacttccatccggttggaattgcctacaacacc
atacgaatgtccattggaggctccgactttgacatggagccctgggcgtataatgaatgg
cctcgtcatgatctgaaattgagcaactttagcgaactcgatccgcgggatctgcagaaa
gtggagcaactgaaacgcctcaaggcaattggcaaggtggatgaactgaagataatgggc
gccgcgtggagtgctccaacctggatgaagagcaacgagcgctggacaggattcgggcag
ctgaaatcggaatattaccaaacctgggccctgtaccacctcaaatttctcgaactcatg
cgggctaaaaatatgccgatttgggccatatccactggcaatgagccgttaaacggcgtc
attggcttcttttttgtacacttcatgagcatgggctggacgccctggcagcaggctatc
tggctgaacgacaatctgggcccgaccatcaggaactcgacggagagcaaggtgctcatc
tttggcaacgacgatcagcgctacacctacccaatgtggttccgaaagatgcgctcctcc
cgcagcaattcgctgtcctacttggatggcctagctgtccactggtactgggatgaactg
ataggtccacagctgattgaccaggcgcacacggatatgcccaacaagctgctgttgaac
acggagtcctgcattggcgataagccatggcagacccatggtcccgagctgggcagctgg
cagcgtggtgagagctacatgagggcttatacccaggacctagcgcacaacttcaatggc
tggctggattggaatctagtgctggacgaacggggcggcccgaactacgtgaacaacttt
gtggacgctccgatcattgtgaatgccacgagtcgggccgagatatacaaacagccgatc
ttctatgccattggccacttctccaagttcctgccgccggaatccgtgcgcatcgagacg
cgaatcgagaagcagggcaatcccttcacccaaatcagtgctgtgggcttccagcgaccg
gacggcagtgtggcgttgatcatctacaatggccaaaaccagccggtggacgtggccctc
gatgatagccagcgtggagcgatcaatctccgcctgccgccgcgctcctggcacacggtg
ctctacaaatga

DBGET integrated database retrieval system