KEGG   Drosophila erecta: Dere_GG11220Help
Entry
Dere_GG11220      CDS       T01060                                 

Definition
GG11220 gene product from transcript GG11220-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
der  Drosophila erecta
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:der00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:der00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:der04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 563 aa AA seqDB search
MKTPWLGFLFALVASSAGATDWQLPCDLRETSHGSVCVCNSTYCDYLEQPQLADPSQIVV
ISSSKDGLRFKKTTGDLSENKPITIDDKQFTDENFNADAILVDQERAWLQLANIPQSLFI
NASIRTYRISVKREQRFQNVSIFGGAFTGTVSYLLKELPAALQDHVYKSYFHPVGIAYNT
IRMSIGGSDFDMEPWAYNEWPRHDLKLSNFSELDPRDLQKVEQLKRLKAIGKVDELKIMG
AAWSAPTWMKSNERWTGFGQLKSEYYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNGV
IGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRNSTESKVLIFGNDDQRYTYPMWFRKMRSS
RSNSLSYLDGLAVHWYWDELIGPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSW
QRGESYMRAYTQDLAHNFNGWLDWNLVLDERGGPNYVNNFVDAPIIVNATSRAEIYKQPI
FYAIGHFSKFLPPESVRIETRIEKQGNPFTQISAVGFQRPDGSVALIIYNGQNQPVDVAL
DDSQRGAINLRLPPRSWHTVLYK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccttggcttggctttcttttcgcactggtggccagctcggcaggtgctacc
gactggcagctaccctgcgatttgcgcgaaacgagccatggcagcgtgtgcgtctgcaac
agcacctactgcgactacctggagcagccgcagcttgctgatccctcgcagattgtggtg
attagcagcagcaaggatggcctgcgcttcaagaagacgacgggggatctttcggagaac
aagcccattacaatcgacgacaaacagttcaccgacgagaacttcaacgcagatgcgatt
ctggtggatcaggagagagcctggttgcagttggccaacattccccagagcctgtttatt
aatgccagcattaggacatatcgcatatcggtgaaacgggagcagcgctttcaaaacgtc
tccatttttggcggcgccttcacgggaacagtctcgtacttgctcaaggaactaccggca
gcactacaggatcatgtctataaatcctacttccatccggttggaattgcctacaacacc
atacgaatgtccattggaggctccgactttgacatggagccctgggcgtataatgaatgg
cctcgtcatgatctgaaattgagcaactttagcgaactcgatccgcgggatctgcagaaa
gtggagcaactgaaacgcctcaaggcaattggcaaggtggatgaactgaagataatgggc
gccgcgtggagtgctccaacctggatgaagagcaacgagcgctggacaggattcgggcag
ctgaaatcggaatattaccaaacctgggccctgtaccacctcaaatttctcgaactcatg
cgggctaaaaatatgccgatttgggccatatccactggcaatgagccgttaaacggcgtc
attggcttcttttttgtacacttcatgagcatgggctggacgccctggcagcaggctatc
tggctgaacgacaatctgggcccgaccatcaggaactcgacggagagcaaggtgctcatc
tttggcaacgacgatcagcgctacacctacccaatgtggttccgaaagatgcgctcctcc
cgcagcaattcgctgtcctacttggatggcctagctgtccactggtactgggatgaactg
ataggtccacagctgattgaccaggcgcacacggatatgcccaacaagctgctgttgaac
acggagtcctgcattggcgataagccatggcagacccatggtcccgagctgggcagctgg
cagcgtggtgagagctacatgagggcttatacccaggacctagcgcacaacttcaatggc
tggctggattggaatctagtgctggacgaacggggcggcccgaactacgtgaacaacttt
gtggacgctccgatcattgtgaatgccacgagtcgggccgagatatacaaacagccgatc
ttctatgccattggccacttctccaagttcctgccgccggaatccgtgcgcatcgagacg
cgaatcgagaagcagggcaatcccttcacccaaatcagtgctgtgggcttccagcgaccg
gacggcagtgtggcgttgatcatctacaatggccaaaaccagccggtggacgtggccctc
gatgatagccagcgtggagcgatcaatctccgcctgccgccgcgctcctggcacacggtg
ctctacaaatga

DBGET integrated database retrieval system