KEGG   Drosophila erecta: Dere_GG11298Help
Entry
Dere_GG11298      CDS       T01060                                 

Definition
GG11298 gene product from transcript GG11298-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
der  Drosophila erecta
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dere_GG11298
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dere_GG11298
Protein phosphatases and associated proteins [BR:der01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dere_GG11298
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dere_GG11298
Spliceosome [BR:der03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dere_GG11298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 327 aa AA seqDB search
MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
RFVYPNFGSSGRPLTPPRGANNKNKKK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatatcatgaacatcgatagcatcatctcgcgtctgctggaggtgcgcggcgca
cgaccgggaaagaatgtgcagctgtcagagagcgagatccgcagcctgtgcctcaagtcc
cgcgagatattcctgtcgcagcccatcctcctggagctggaggcaccgctaaagatctgc
ggcgacatacacggacaatactatgacctcttgcgcctgttcgaatacggcggctttccg
cccgagtcaaactacctgttcctgggcgactacgtcgatcgtggcaagcagtccctggag
acgatatgcctgctgctggcctacaagatcaagtacgcggagaacttcttcttgctgcgc
ggcaaccacgagtgcgccagcatcaaccgcatctacgggttctacgatgaatgcaaacgt
cgctacaccatcaagctgtggaaaacgttcacggactgctttaactgcctgccggtggcc
gccatcgtggatgagaagatcttctgttgccacggcggcctgagtccagatctgtcgtcc
atggaacagatacgacgcatcatgcgtcccacagacgtgcccgaccagggactgctgtgc
gatctgctgtggtcggatccggataaggataccatgggctggggcgagaacgatcgcggc
gtgagcttcacatttggagcagaggttgtgggtaaatttttacagaagcacgaatttgac
ctgatctgtcgggctcatcaggtggtggaggatggttatgagttctttgccaaacgccag
ctggtgacgctcttctcggcgcccaactactgcggggagttcgacaacgcgggtgccatg
atgtccgtggacgacacattgatgtgctccttccagatattgaaacccgccgacaagcga
cgatttgtttatcccaactttggcagctcaggacgtccgttgacaccgccacgtggggcc
aacaataaaaacaagaaaaaataa

DBGET integrated database retrieval system