KEGG   Drosophila erecta: Dere_GG11411Help
Entry
Dere_GG11411      CDS       T01060                                 

Definition
GG11411 gene product from transcript GG11411-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
der  Drosophila erecta
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dere_GG11411
Messenger RNA biogenesis [BR:der03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dere_GG11411
   mRNA cycle factors
    P-body specific factors
     Dere_GG11411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1320 aa AA seqDB search
MEFDGAENGLGMEFGGRGILREINKNDGGIKMDFLASIIKRPKSIATTGITTNQPTTMDA
LEAASPTNDCSTPRDKEGLPLVSAHLDTLLQSASEDLQRLEEQHCNLIMEPISSPLPAHE
DTSSSRESIQKFLSEINFNLNQVSDNEMEHLQAMSGELSPLAVKPIPKPTSMEQQKAMAA
ALGHQTAVAGGLQLDADMVPKFGGLPEFDETQIPELAPLSTDIDTQLKSNHSDSDVFVEC
LSLHSERYTGDRSELEAYSSALNDVLEQQLSMSSVSALEAEFKDPLQVSQHNNDSYEAMD
VDEINETMEMLKDVLESEDHHLMQTHILSVSQSKKENSEQYNQNQEQKIDQDQLAKHPGS
NSDAKEPPLIESVLPEESGTPLPEPELALTALDSANDLAKHHEEKQKDTEDVFQKEDHHP
ICSAQMRNAQNPLEYLNQEKFSVAVESPERTCTAINLEQNASPAIEATEDRTVEELEHME
VDDSMRVDETIMLASSRQEQNNAHSPAPSKSFLKLCGKNDKDFQDNKMDNKTAGIESPLK
MDEIEIPVESVPAALTLPLPTLQTESKDLPLSPPIPTHRPKTAEELEFLALRELPLPDDV
PTGEKVGVKKLSHGRTLVAAVTPTQLRSTTHLSLDLDGNRSTASLPQPTSPSFPISEPAE
KQSHFPRSPHAPPEQKEMPYLEEAVVEPSSNRKESVFEAGVIAKSAIVFELTQPSPQKQD
LNETLPMSEISPTPLNMTFDSESITESKSQKGTENIEASSTFAVSLGSVDDNQRRTFSVL
QSTTEEKEDKSRRTFCMQKENPRRTFCMEQNASPALEATENTGADDFKDVDISMKGDDVA
AMKSPQQTLKDRQAPISNSPPIPTHQHLNRLPIHEAKFPVSPLGNGTVVLEEQALSAKEQ
ATLSASDEKDDVFLEHFGVISPVSDDMFRTISGSDEQAKIRVNADVEIGGKNAAAMNRKR
GGATGEQEAIIDPEFQDGANIQNRSNNAPIDRSSLLLKFDPLLGVPVAVNHPNQQEQALQ
NILGSNQYQNRLLSPTLEEHETSDGNQSAGLISSAKDTAKKWDFKPPVYRTKKHVKMSVD
VIDNDCNKTFDNSNPNTEDKTQNYNDMDELEKKIKNEVTRSEDIEKKLKEGEQREEALIK
RITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQTDRDANYHHLTSLET
TFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLEIANK
KLDTYAREHADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGS
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgacggagcagagaatggccttggaatggaatttggcggtcgcggaattctg
cgggagatcaacaaaaacgatggcggcattaagatggacttcctcgcaagtatcatcaaa
aggccaaagagcatcgctaccactggcatcaccaccaatcagccaacgacaatggacgcc
ttagaagctgctagtcccactaatgattgttctacaccaagggataaagaaggacttcca
cttgtatccgcgcacctggacacgttactacagtccgcctctgaggatctgcagcgactg
gaggaacagcactgtaatttaattatggaacccatctcgagcccacttccagcccacgag
gacaccagtagtagtagagaatcaatacagaaatttctaagcgaaataaacttcaatctg
aaccaagttagtgataacgaaatggagcacttgcaagccatgagtggcgagctgagtccg
ctggcggtgaagcccattcccaagccgacgagcatggagcaacagaaggcaatggcggca
gctctgggacatcaaacggcggtagccggtggtcttcagctagacgcggacatggttcca
aaatttggaggtcttcccgagttcgatgagacgcaaataccggaactggctcctttaagt
accgatatagacactcaactgaaatccaaccattctgactcggatgtttttgtcgagtgt
ttatcgcttcatagtgagcgctataccggagatcgatcggagttagaggcctattcaagt
gcccttaatgatgttttggagcagcagctgtccatgagctcagtttctgcactggaagca
gaattcaaagatcctttgcaagttagccagcacaacaacgacagctatgaagcaatggat
gtggatgaaataaacgaaaccatggaaatgttaaaggacgttttggaatctgaagaccat
catcttatgcaaacgcatattctcagcgtatcccagtcaaaaaaagaaaattctgagcag
tataatcaaaatcaggagcaaaaaatagatcaagatcagttagctaaacaccctggatcc
aatagtgatgcaaaggagcctccattaatagaatcagtattgcctgaggagtctggtacg
ccattacctgagccggagctcgccttaactgccttggactctgcgaatgacttagctaag
catcatgaggaaaagcaaaaggatacagaagatgtgtttcagaaagaggaccaccacccg
atctgtagtgcacagatgaggaacgcacaaaatcctctggaataccttaatcaagagaaa
ttttcagttgcagtagaatcaccggaaagaacatgcactgccatcaaccttgagcaaaat
gcatccccagctatagaggcaactgaagacaggactgtggaggagcttgagcacatggaa
gtggatgactccatgagagtggatgagaccataatgcttgcctcatctcgtcaggagcaa
aataatgctcattctcccgctccaagcaaatctttcttaaaactctgcgggaaaaatgat
aaggattttcaagataataaaatggataataaaactgcaggcatagaaagtccattgaaa
atggatgaaatagagataccggtagaatctgtcccagcagcgctgaccttgcccttgccg
acacttcaaaccgaaagcaaggacctgcccctttctccgcccatacctacacatcgccca
aagacagcggaggaactagagttcctggctctgagggagttacccttgcctgatgatgtc
ccgacgggtgagaaggtgggagtaaaaaagctatcccacggtcgcacgctcgttgcggca
gtcacaccaacgcagctgagatccacgacgcatctctccttggatctggatggaaataga
agcactgcaagccttccacaacccacttcgcctagtttccccatcagcgaacccgctgaa
aaacagtcccactttccacgctcaccccatgctccgcctgagcaaaaggaaatgccctat
ttggaagaagctgtggtagaaccttcttcaaatcgcaaggaaagcgttttcgaagccgga
gtcatcgccaaatccgcgatagtctttgagttaacacaaccgagtccgcagaagcaggac
ctcaacgaaaccttgcccatgagcgagatttctccaactcccttaaatatgacctttgac
agcgaaagcattacggagagcaaatcacagaagggtacagagaacattgaggcttcctcc
acattcgccgtaagtctgggatcggtcgatgataaccagcgccgcactttctcggtgctt
cagtctacgacggaagagaaagaggacaaatcgcgtcggactttttgtatgcaaaaggag
aacccacgccgcaccttctgcatggagcaaaatgcttctccagcattggaggccactgaa
aataccggggctgatgacttcaaggatgtagatatctctatgaagggagatgatgtagcc
gccatgaagtcgccccagcaaactttgaaggatcgccaagcaccaatttcaaattcacca
cctattcctacccaccaacatttaaatagactccctatccatgaggcgaagtttccggtg
tcaccattgggaaatggtaccgttgtgttggaggagcaggctctctccgccaaagagcaa
gccacgctaagcgccagtgatgagaaggacgatgttttcttggagcactttggtgttatt
tctccagtttcggatgacatgttcaggaccatcagtggttccgacgaacaagcaaagatt
agggtcaatgctgatgtggagattggaggaaaaaacgctgctgcgatgaacaggaagagg
ggtggtgcaaccggcgagcaggaggcgattattgatccggaattccaggatggcgccaac
atacaaaaccgcagcaataatgcgcctatcgaccgcagttcactgctgctgaagttcgat
cccctccttggagtccctgttgccgttaatcatccgaatcagcaggagcaggcgctgcag
aatattctgggatcgaaccagtatcaaaaccggctccttagcccaacattggaggagcac
gaaacaagtgacgggaaccagtctgcgggattaatatcgagtgccaaagatacagccaag
aaatgggattttaagccacctgtgtatagaacaaaaaagcatgttaaaatgagtgtagac
gtcattgataacgattgcaacaaaaccttcgacaattccaaccccaatacggaggataag
acgcagaactacaacgacatggatgagctggagaagaaaatcaaaaatgaagtaacaagg
tccgaagacattgaaaagaaactcaaggagggagagcagcgcgaggaagcactgatcaag
cgtattacggagaaggacaagacaaatgcaaaactgaacggtgtcatcgaagcatatgag
aaggcaatcgcggagctcattagtgagaaggagcagcaggcgcagctccacgagcgccag
ttgcaagaagtccagacagaccgggacgccaattaccatcacttaacgtcattggagacg
acattttccgatctgcatgtgaaatacgaaaaaagcaaagagatgacctcgcagcttaaa
agcaatgaggaatccctcctggcggagcggaagcagatgatggacaatctacggttgcag
gaacaacgctacgacaagatgaagaaccatgccatgcagcagctggaaattgcaaacaaa
aagctggacacctacgcgagggagcatgccgacgagacgaaaaaacttaaagctttactc
aagaaggaggagatctcgcgggtctcgatgacggagcagctgcaacagaaatcgcgcgaa
aacgccgatttgctcaagatctgcgaagagctcatctatggcaagggacaaggtggtagt
taa

DBGET integrated database retrieval system