KEGG   Drosophila erecta: Dere_GG11600Help
Entry
Dere_GG11600      CDS       T01060                                 

Definition
GG11600 gene product from transcript GG11600-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG11600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MDKSNSSQLQETSDTKIQKVQHSPDQEEISKKDESKVQDDPVEGIQEHGSISENINIIRK
LQFGRYEIETTFSSAYPEMDDKVPNIYVCEFCLKYMYLRTSYSYHLSDCKIRRPPGSLVY
RKDDIHIYEVDGNKELLYCQFLCLMSKLFLENKETLYTPNLFLFYILCLKDKDGEHLVGY
FSREKKSTPNINLNCIVVLPPYMRRGYGKLLIDLSYEISRKEGVIGGPKKPLSEVARLCY
LSYWGHNLLELLRRHSSPALIAIEQLSETTGFLKKDIMLTLKFMKIATYYKDGCTMCTTP
SIIENRRRLVKFKKPRLIIYRNCLAWKTTTAEE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatcgaattcttcccagctccaggagacatcagatacaaaaatacaaaaagtc
caacattcccccgatcaggaggagatcagcaagaaagatgagtcgaaggtgcaagacgac
ccagtagagggtatacaagaacatggatcaatttctgaaaatataaacataattcgaaag
ttgcagtttgggcgctacgagatcgaaaccacgttttccagtgcgtatcctgaaatggac
gacaaggtgcccaacatttacgtttgtgagttctgcctgaaatacatgtatttgcgaaca
agttactcctaccacctgtccgattgcaagataaggcgtccgccgggcagcttggtatac
agaaaggacgatattcatatctacgaggtcgatggcaacaaagagctgctgtattgccag
ttcctctgccttatgtccaagctctttctggaaaacaaggaaacgctttacaccccgaat
ctgttcttgttttatatactgtgtttaaaggacaaggatggcgagcaccttgtaggttac
ttctccagggagaagaagtctacgccgaatatcaaccttaattgcatcgttgttttaccg
ccctacatgcgcaggggctacggaaagctgctgattgacctcagctacgagatctctcgc
aaggagggagtcatcggaggtcccaagaagccgctgtcggaagttgccaggctttgttac
ctcagttattggggccacaacctcctcgaactgttgaggcgccactcctcgccggccttg
atagccatcgaacagctgagcgaaacgactggcttcctcaagaaggacataatgctcact
ctaaaattcatgaagatagcgacgtactacaaggatggctgcaccatgtgcactactcca
tcgataatcgaaaatcgccgtaggctcgtgaagtttaagaaacccaggctgatcatttat
agaaactgcctcgcctggaagacaaccacagccgaagagtag

DBGET integrated database retrieval system