KEGG   Drosophila erecta: Dere_GG11626Help
Entry
Dere_GG11626      CDS       T01060                                 

Definition
GG11626 gene product from transcript GG11626-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dere_GG11626
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dere_GG11626
Spliceosome [BR:der03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dere_GG11626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2969 aa AA seqDB search
MSNEFSELIALGCPDLAAQKPQGGSTQVELILNTERRLSIKQMTATDLATLRATAAAEAE
ARSRSQAEAEARAIAQEQLRQAREAESKARARAALEVQAQLQRVMESEKRRQQEEKERRS
RQQAEAEEQEQEQEVDEDEEEEEEELAKGSLPTNSGPRERIASLPSNIDDAMEMHLLSVS
HPKASSKDDSPPKSSSHIADSIELLRMQRAARDARSHNRSRERSISPERNHERSAAPDRL
QSSVSMSSLDSASVSASASRQPSKADSRRGSTTSATGVEPPLMAPPSQSTKFPLTKTVSA
PNMNRRRSSLTSLFPGPSPLVAPEPSLHTNPDPRVQEQIEEDRRRRRMDDGYREIPSGKM
VHRTKTPPPVGTNLGVSLKRVTAPSGSITIKPKESPMLGVVLRRVEKKTVPQKSILDDDK
PLYHFSIVRSDHKEHVPAQKPKPKPAPPAAKPSPGGILTGPQVIRTAPKQPVPAKPQRPM
PGVPITITKIEGDKIIIIKKIIVPKNSKIPEQYLQVGRRRVGDRLVVSVVRLVFGVSFLL
CFVRNLFYRIYLDVSSSAAPSPSLKTKEESQPAMQKPTPPPASGQQFFQVVSPQFASVLS
SSIPESKCAVRSPISSPLAIRKSRPPLLPASPKSTPPLPRKHHPLAYNAATGTISSASGA
ALPSRLMTTIASSPASSISLSSCSSPSSSPPPPVPCRAPKNASKSVAAAAPPLSTSNEIS
LDKLLQQQQELEEKSAAATNSAKMDANFYDAEIEMMNKYLKSLPDYSELDRKLHQEFQEC
EDLYDKIKRQQQPLAKSNSQQSVTKAVGPGVPAISSGLSKSSSINFAQNPSSRGAAPRLA
YPSIFSQAGGEPKLQRSISSSNMPLSAPTPMRPLPTKNGLQSGSNLSLNKQLMNEFWSEN
LTSSQKRQTPKRTFWNYEKICGAQLGDAGQPFKVDAKTAKKLAIFDPTVAEAAQKELQRP
QQSQVPQNHPHKLQKNASLSHLDLKVRQAVTKDDLYKLICNEQSPLAGSNFVSRVPVKQQ
TSAQQQQVLPKSMSMTHVPGGGQPMGAPLLRTSSRTHIPCYMKNLPSLSRSTSNSAILMT
QPRKEPPPKEPLKAPAPLPALAAAPPAVSKPSGVLKSSSSSCVPSPRCAAAFFRRPQESN
NAQQQHHQPLQKPQQVAPIEESGPGDSASLERKSEKSNSTISTSSFTVTNCCTTHLPQLS
KFTSSFHIAPTTATTTAATATPTPTVAATTSDQHHQQQQQSGPAAAMASANLEVPTSSSS
SAATKRQKDVDNKLEKCLNDMLKLKTNSSSNSNSTTNSNNNAIMSQSLTGEHKDPKSALE
GPTNSSSSKYVGESQIPVPVQLYDPQKPLLQQQQQQQRICYPIGKSNSTSQLPMGGYQRL
LQQQQQQQQHHQQQQQQHQEQQQYPQHKRPFLNWNSFACSAMNGASDPFMQQQHMPAHQQ
QQHLPHKLQQSYSSSHLPKQAPKSGLAMFLQKNTNKENKFGQPMQQQPLGMMPQMYGYQA
PQQQSKMGYPRTGAPLTHSASFSSAQRPTALQFHQQHQQQQLQQQQQHPQQQQQQHSSFG
LGMMSRNYYNVPKQPERKPLQTFDPYAYPKPNQMQPVKYQQQQQQQHQQQQPHPHTQFLN
ASAGGGGGGAAGLQYDPNTNTQLFYASPASSSSTKQPHQPQQQQQQQSQLQQSNSVIFNH
SGQQHQPHQQQQNEMSKSALGLHFIEPLRGVKYYPIVVIVIADQTHAKSAAAKRISDIRK
SQGMATFLNRFHREKSEKILPATAVAENGKTADAEAEAVPQQRPQRRYMRSATAASVTQL
LSESCNSLLQRFRRNPSERPDNKQQQQQQQQQQQQRNRATAIVEDPKDSTPTTNDSNNNN
NKGKGGSSNQAQKLSKRRRSSDKSSTSRRHPDGDRERERERDRERDRDRQQDKEREMADR
HRRYYAAGGLGSTTGLGYHPSSSGSTSTAALMGRYQKSSTTANALDRLRTHLSPVGGYYK
PLIRGLGGGRRDLDDRRDLLLDKDRTPTTSAISTGGKQSAISRLENKYSDILERAAGRRR
HEEDRDKTLEPDDYGASGSGGLLRSATSHQLAKSKLSSSSFNASDRKERTPYRTRAQRQR
YMAESNDSGYLTSGNRLLDENYPVDYGQRYDYHDALRLGGASGYPSSRYGRRAGEEEALS
PRSTRAYGRTKTVESLLAAEIQDSGRNAAGHAEDRPLNSRNRFAHRRKEQPPPELTAEER
EILADDRSSEDNAAILMLLREDNQFLEAKKFEERMRKRRELRDRVKRMEEAAEEAKKTEA
AVAAAEAEAAALEQEAKKAKEAAAAAANAAATAAAAATSSAPAATLAPPQEAPKKKSRSK
KVTRDGSDCSGSSESTSGSSSSDEAETETETDSAAPGVQLTHTADTTPQTQIPSVNGNTT
SSSISTTTNPSNTATNSSTSTSALSNHTTAAATALSSGTTNKSRFLPHSDRNNNDLAKYK
PSSQLMHSSSSGALAFGGIGARLAAADARRQQQRYQGASSRTAAVLNEFDRYKPPGSGTG
SGSSYLHDSYSGSSRRSNALGGGSSLYPQRSQLDAYQQQYQQSSSYLQHDHYQLAKSATS
SALFNRSRIPKTLSTFTAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVK
DMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIV
FEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSD
YTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPC
DVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDE
KSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLP
PHHRVGEVSNKQPLSSGSSSRERSHSLSR
NT seq 8910 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaatttagcgaactgatcgcccttgggtgtccagacctcgcggcgcaaaag
ccgcaaggcggcagcacccaggtggagttgatcctcaacactgagcgccgcctgagcata
aagcagatgacggctaccgatttggccaccctaagggcaacagcagccgcggaagcggag
gccagatcgcgatcacaggcggaggcggaagctcgggcaattgcccaggaacaattgcgt
caggcccgcgaggccgagtccaaggccagagcacgtgctgccctcgaggtgcaggcccaa
ctgcagcgagtgatggagagcgagaagcgcaggcaacaggaagaaaaggagcggcgcagc
aggcaacaggcggaggcggaggagcaggagcaggagcaggaagttgatgaagacgaggaa
gaggaggaagaggaactggccaagggttcccttccaaccaattcaggaccaagagaacgc
attgcctcgctacccagcaacatagatgatgccatggagatgcaccttcttagcgtttcg
caccccaaggcctcttccaaggatgattcaccgcctaagagcagctctcacatagcggac
tccattgagctgctgagaatgcagcgagctgctcgcgatgcacgatcccacaatcgcagt
cgagagcggtccatttcgccagaacgtaaccacgaacggagcgctgcaccagatcgcctc
cagagttccgttagcatgagcagtttggactcggccagcgtcagtgcatcggcatccaga
caacccagcaaggcagacagtcgacgtggaagcactacgagtgccacaggtgtggaacca
ccacttatggcaccaccttcccagtctaccaaatttccactcactaagacagtgtcagcg
cccaatatgaaccgccggcggagcagtctgacatcgctctttcctggcccatctccttta
gtagcacccgaaccatctctgcacactaatcccgatccaagggttcaagagcagatagaa
gaggatcgtcgtcgccgtcgaatggacgatggttaccgtgagatacccagtggaaaaatg
gtgcatcgaacgaagacaccgccgccagtgggcacaaacctcggagtgagtctcaagcgg
gtgacagcgcccagtggatcgataaccatcaagcccaaggagtcgcccatgctgggagtc
gtcctgcgtagagtggagaagaaaactgtaccgcaaaagagcattctggatgacgacaaa
ccactgtaccacttctctattgtgcgcagcgaccacaaggaacacgtgcctgctcaaaaa
ccaaaacccaagcctgctcctccagctgctaagccaagtcccggtggcatcctcactgga
ccccaagtaattcgaaccgctcccaagcaacctgtgcccgccaagccacagcgtcctatg
cccggcgttcccatcacaattaccaagattgaaggcgacaagatcatcatcatcaagaag
atcattgtgccgaagaacagtaagataccggagcagtatctgcaggttggtcgtcgtcgt
gttggtgatcgccttgtggtgtctgtagttcgcctggtgttcggtgtctccttcctcctg
tgttttgttcgaaatctgttttatagaatttacctcgatgtttcctcctccgccgcccca
tcgccaagcctaaaaacaaaagaggaatcccagccagcgatgcaaaaacctacgccgccg
ccggccagtggccagcagttcttccaggtggtctccccacagtttgcctcggtgctatcg
tccagcatcccggagagtaagtgcgcggtacgttctccgatatcctcgccattagcaatc
cggaagagtcgtccgcctctgctgccggcgagtccaaagtccacgcctccactaccgagg
aaacatcatcctcttgcctacaatgcggcaacgggaacaatcagcagtgcctctggagca
gcgttgccctcccggctaatgaccacaattgcctctagtccggcttctagtatttcgctg
tcctcctgtagttctccttcatcatctccacctccgccagtaccatgtcgtgctcctaag
aacgccagtaaatccgttgctgctgctgctccacctctgtccacctcaaacgaaatcagt
ttggacaagttgctgcaacagcagcaggagctggaggagaaatccgcggcagcgacaaac
agcgctaaaatggatgcgaacttctacgatgccgagatcgagatgatgaacaagtatctc
aaaagcctgcctgactacagcgaactggacaggaagctgcaccaggagttccaggagtgc
gaagatctctatgacaagatcaagcgtcaacagcaaccgctggcaaagtctaattcgcag
cagtcggtgacgaaggcagtaggaccaggagtcccggccatctcctccggcttgtccaag
tcgtcatcaattaactttgcccagaatcccagcagtcgtggagctgcaccgcgtttggca
tatccctcgatattttcacaggctggaggcgagcccaagctgcaacgcagcatttcaagt
tctaatatgcctttaagtgcgcctactccaatgcgtccgctgcccaccaagaatggccta
caaagtggctccaatctgtcccttaacaaacagttgatgaacgaattctggagcgagaat
ctgaccagttcgcaaaagaggcaaacgcctaagcgaaccttttggaactacgagaagatc
tgcggtgcccagttgggcgatgcagggcaaccctttaaggtggacgctaagactgccaag
aaattggctatttttgatcccacagttgccgaggccgcccaaaaggaactgcagagacct
cagcagtcacaggttccacaaaaccatccccacaaattacaaaagaatgcgtcgttgtcg
cacctggatctaaaggtgcgtcaggcggtcaccaaggacgatctctacaaactgatctgc
aacgagcagtcgccgctggctggatcgaattttgtgagtagagtaccggtgaagcagcaa
acctcagcacagcagcagcaggtgcttccaaagagcatgtccatgacgcatgtgccgggt
ggtggtcaacccatgggagctccattgctgcgaacttctagtcgcactcatataccctgc
tatatgaagaatctaccctcattgagcaggagcacatcgaactctgcaatactcatgacc
caaccgcgcaaggaacctccaccaaaggaaccactgaaagctccagcaccacttcctgcc
ttagctgctgctccaccggctgtaagcaaaccgagtggtgtcttgaaaagctccagcagt
tcctgtgtcccttcaccccgttgtgccgctgccttctttcgccgaccccaggaatctaac
aatgctcagcagcaacatcatcagccactgcaaaagccgcaacaagtggcgcccatcgag
gaatccggaccgggggattccgcgtctctcgaacgcaagtcagagaagagcaacagcacg
ataagcacaagcagctttacggtgaccaactgttgcaccacccacctgccgcagctctcc
aagttcacctcatcgttccatattgcccccaccacagcaacaaccacagccgcaacagcc
acaccgaccccaacagtagcagcaacaacaagcgatcagcaccaccagcagcagcaacaa
agtggcccagcagctgcgatggcatctgccaacttggaggtgccaacatcgtcatcgtcg
tcagcggccacaaagcgccagaaagatgttgacaacaagctagaaaaatgcttgaacgac
atgctaaagttgaagaccaacagcagcagcaacagcaacagcactactaacagcaataat
aatgcaatcatgtcgcagtcgctgacgggcgagcacaaagacccgaagtctgcactcgaa
ggccccacgaacagcagcagcagcaagtacgtaggtgaatctcagatccccgtgccagtt
cagctctacgatccgcagaagccgttgctgcaacaacagcagcagcaacaaaggatctgc
tatcccataggcaaatctaactctacctctcagctgcccatgggcggctaccagagattg
ctgcaacagcagcagcagcagcagcaacatcaccaacagcaacagcagcaacatcaggaa
cagcagcagtatccgcagcacaagcgacccttcctcaactggaatagctttgcatgttcc
gccatgaacggagcgagtgatcccttcatgcagcagcaacacatgcctgcccaccagcaa
cagcaacatctgccacacaagctgcagcagtcctactcctcttcgcatttgcccaagcag
gcgcccaaatctggacttgccatgtttctgcagaagaacaccaacaaggagaacaagttt
ggccagccgatgcagcagcagccactcggcatgatgccccagatgtacggctaccaggcg
ccccagcagcaatccaagatgggctatccccgcaccggtgccccactgacgcactcggcc
tccttcagctccgcccaaaggccgacggccctgcagtttcaccagcaacatcagcagcag
cagctgcagcagcagcagcaacacccccagcagcaacaacagcagcattccagctttggg
ctgggcatgatgagtaggaattactataatgtgcccaagcagccagagcgcaagccgctc
cagaccttcgatccgtatgcctatcccaagccaaatcagatgcagccggtcaagtaccag
cagcagcagcagcaacaacatcagcagcagcaaccgcatccgcatacgcagtttctgaat
gcttccgctggaggaggaggtggcggtgccgctgggcttcaatacgatccaaatacaaat
acgcaattgttttacgcgtcgccggcgtcatcgtcatcgaccaagcaaccacatcaaccg
caacagcaacagcagcagcagtcgcagctacaacaaagcaattctgtcatattcaatcac
tcgggccagcaacaccaaccacaccaacagcagcagaatgaaatgtccaagtccgcgttg
ggactgcacttcatcgagcccctaagaggcgttaagtattatccgattgtcgtcatcgtc
atcgcggaccagacccacgcgaaatctgccgcagcgaagaggatttccgacatccgaaaa
agccaaggaatggccacatttctgaatcgttttcatcgcgaaaaaagcgaaaagatattg
ccagcgacggcggttgccgaaaacgggaaaacagctgacgcggaggcggaggcggtaccg
cagcagcgtccacagcggcggtacatgcgaagcgccaccgccgccagcgtcacgcagctg
ctctccgagagctgcaacagtctgctgcagcggtttcgacgcaatccaagcgaacgacct
gataacaaacagcagcagcagcagcaacagcagcagcagcagcaacgcaatcgtgcgact
gcaatagtcgaggatcccaaagactcgactccaacgacgaatgacagcaataataacaat
aacaagggaaaaggtggatccagtaaccaggcccagaagctaagcaaacgtcgccgcagc
tcggacaaatcctcgaccagccggagacatccggacggggatagggaacgggaacgagaa
cgagatagggaacgagatcgggataggcaacaggacaaggaacgcgagatggccgatcgc
cacagacgctactatgcggccggaggactcggcagcaccacaggattgggctaccatccc
agcagcagcggaagcaccagcaccgctgccctgatgggtcgctaccagaagagctccacc
acagccaacgccctggacagactgcgcacccacctgagtcccgtaggcggttactataag
ccactgatccgaggattgggaggcggcaggcgggacctagacgatcgaagagatctgctc
ttggacaaagacagaacgccaaccacctcagcaatttccacaggaggcaagcagtcggca
atttcccggctggagaacaaatactcagatatcttggaacgagcagccggaaggcggcgc
catgaagaggatcgcgacaagaccctggagccggatgactacggtgccagtggtagtggc
ggactgctccgctcggccacttcccaccagctggccaagtctaagttgtcttccagctcc
tttaatgcttccgatcgcaaggagcgcactccataccgaactcgagctcagaggcaaagg
tatatggccgagtccaatgacagcggctatctgaccagcgggaatcggctgctggacgag
aactacccagtggattatggccagcgttacgactatcacgacgccctacgcctaggagga
gcatcaggttatccctccagtcgctacggccggcgagctggcgaagaagaagccctctcg
cctcgctccacaagggcgtatggtagaaccaaaaccgtggaaagtctactggctgctgaa
atccaagacagcggtcgaaatgcagctggacacgccgaggatcgaccattgaactcaagg
aaccgctttgctcatcgacgtaaggagcagccaccaccagaactgaccgctgaagagcgc
gaaattcttgccgacgatcggtcttcggaggacaatgcagccattctgatgctgctccga
gaagacaaccagttcctggaggcgaaaaagttcgaggagcgcatgcgcaaacgccgtgag
cttagggatcgcgtcaagcgcatggaagaagcggccgaggaggccaagaagactgaagca
gcagtagcggccgcagaagcagaggcagctgctctcgagcaggaggccaaaaaggccaag
gaggcagccgcagcagcagcgaatgcggcagcaactgctgcagctgccgcaacatcatca
gcaccagcagccacacttgcaccgccgcaggaggcgcccaagaagaagtcgcgcagcaaa
aaagtaactagagacggtagcgattgcagtggctcctccgagagcacctcgggcagtagc
tcatccgatgaggcggaaacagaaaccgaaacggattcggctgcgcccggtgtgcaacta
acccacacagcagacacaaccccacagacacagatcccgtctgtaaatggcaacaccacc
agctcctccatctccaccaccaccaacccctccaatacagccaccaactcatccactagc
acttctgctctttctaaccacacaacggcagcagcgacggcactctcctccggcaccacc
aacaagagccgctttctgccccactcagatcgcaacaacaatgacctcgccaagtacaag
cccagcagccagctgatgcactcctccagctccggggcactggccttcggtggcattggg
gcgcgcctcgcggctgcagatgctcgacgtcagcagcagcggtatcagggcgccagctca
cgtaccgccgccgtgctgaacgagttcgatcgctacaagccgccgggatctggaacgggc
tccggatcgagctacctccacgactcgtacagcgggagtagtaggcgatccaatgccctg
ggaggaggcagctcgttgtatccccagcgatcccaactggatgcctaccagcagcagtac
cagcagtcgtcctcctacctgcagcacgatcactaccagctggccaagagcgccacctcg
tcggccctgttcaacaggtctcgcattccaaagacactctcgacctttacagcaaagccc
gtcattcaagatgatgctgatggtcacttaatttaccacaccggagacattctccatcac
agatataagatcatggccacactgggcgaaggaacttttggacgtgtggtcaaggtcaaa
gatatggagcgtgattactgcatggccttaaagattattaagaacgtggaaaagtaccgc
gaagctgccaagctggagataaatgctttggaaaagattgcccaaaaggatccgcattgc
gatcatttgtgcgtgaaaatgattgactggtttgattatcatggacacatgtgtatagtt
tttgaaatgttggggctcagtgttttcgattttttgcgagagaacaactacgagccatac
ccgctggaccaagtgcgccacatggcctatcaactatgctattctgtgaaatttctacat
gacaatcgtttaacgcacaccgatctcaagccggagaatatactcttcgtcgactcggat
tatacttctcactataatcataagattaaccgggaggtgcgccgcgtcaagaacacggac
gttcgcctgatcgactttgggtcggccaccttcgaccatgagcaccacagcacaattgtc
tcgacgcgacattaccgcgcgccagaggtcatactggagctggggtggtcacagccgtgt
gacgtttggtccattgggtgcatcttgttcgaactgtatctgggaatcacgctcttccaa
acgcacgacaatcgcgagcacctggccatgatggagcgaatcttgggacaaataccatat
cgcatggcacgcaaaaccaaaacaaagtacttctatcatggtaagttggattgggatgag
aagtccagtgcgggtcgctacgtccgtgatcactgcaagccgttgttcctgtgccagctg
agcgacagcgaggaccactgtgagctcttcagtctgatcaagaagatgctggagtatgag
ccctcgtcacgcattacgttaggcgaagccctgcatcatccttttttcgacaggctgcca
ccgcaccatcgagtgggtgaggtcagcaataagcagcccctttcgtcgggcagcagcagc
cgcgaaaggtcgcacagcctctccagatga

DBGET integrated database retrieval system