KEGG   Drosophila erecta: Dere_GG11658Help
Entry
Dere_GG11658      CDS       T01060                                 

Definition
GG11658 gene product from transcript GG11658-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dere_GG11658
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG11658
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG11658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1091 aa AA seqDB search
MHEYDVNERKEEPASLPPTQNETTDTVGQSQDHHNDSTKVNSQLPQDQRNQEQDNPIRQQ
DNNQPLQETPTKQQQEEVSILYPLVVCEQVAVTQPILIADTPKRSPVKKRQRRVYVADTL
RCSSLRSRQEPEAKDPLEGGLKQPEVAPPPPPVQAPSPTPTESIEYTPPGLFKPEFWNSI
EEAQEPKTVVKKRRAAGGLKRTRGNKLLREIEIHSPETAAAIAAAQAELNAAGKQHSGAA
GARASRKRTNTMSLYDRRFQTTTDERRVANGYGGNAARSGTGSSSNEIESQELQSHQYYG
PNGGSNAAGAAAGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLHHLI
QDLNVVQQTIVRQQTARSASLGRNVSAAQLEHARSWSSKDLVTSTDQYSGQNGGVNSGNG
GSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAH
EFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDSGESQDRTDSTASQNVSSGN
GSVATSQITTTKTSFFSRKSKRKDEVKSSKSTRVQSPLKDNSPTAGGLTGAGTAHATANS
LFYLNTVDLSGASSTSGSASTSASGVVPTSVALPTLPQATKYSSDDEMNSAAVLKDKMRL
EERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKP
STYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVST
YVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVN
CPKDRRNTMTNSQTMTSQTVASNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKF
GRSKASSSGDMSKNVKQVNGTSSKNITNGIGKLSMNTTCQGVNCCAMRLCCSQQTSGSNS
ASCSDFSEETLQNGSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCDDDK
IKAMTQREFEELLSPTRKITITPYLLFYARFDLQPHKATPPKPGSSSTPPPPSSAQSSWS
NENMASGSHKI
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggaaccagccagtcttccacccactcaa
aacgagaccactgacacggtcggccagagccaggatcatcacaacgattcaactaaagtc
aacagccagctgccacaggatcagcgaaatcaggaacaggataatcctattcggcagcag
gacaacaatcagccgcttcaggaaacgccaactaagcagcagcaggaggaagtttccatt
ctttatcctttggtagtctgcgagcaggtggcagtcacccaaccaattctgattgcggac
acgccgaaacgatctccagttaagaagcgccagcgacgcgtttatgtcgccgacaccttg
cgctgctccagcctacgttcccgtcaagagcccgaagccaaggacccactggaaggtggc
ctaaagcagccggaagtcgctccaccaccaccgcctgttcaggcgccctcgcccacgccg
acagaatctattgaatacacacctccaggcctctttaaaccggagttctggaacagcatt
gaagaggcccaagagccgaagaccgttgtgaagaagcgacgtgccgctggaggactcaaa
aggacgcgcggcaacaagcttctgagagagatcgagatacattcgccggaaacggcggcc
gcaattgcggcagcacaggccgaactcaacgccgcaggaaagcagcactcgggagcagca
ggagcacgggccagccgcaagaggaccaacacgatgtctctatacgatcggcgattccag
acgaccaccgatgagcgccgcgtggctaacggatacggaggcaatgcagcgcgttcgggc
actggctcctcgtcaaacgagatcgagtcccaggagctgcagagccatcagtattacggt
cccaacggtggcagcaatgcagcgggagcagccgcaggcttgaacggaagtgcggcggcc
ctgaaccatgccccttctatgggcacactgtgcaacataggcaacagttgctacttgaac
tcggtggtatacaccctgcgctttgctccgcactttttgcacagcctacaccacctgata
caggacttgaatgttgtgcagcagacgattgttcgccagcagacggccaggtctgcgtca
ctcggcaggaatgtgagtgccgctcaattggagcacgcccgcagctggagcagcaaagat
ctggtcaccagtacggatcagtacagcggccagaacggcggagttaatagcgggaacggt
ggcagcggttcgagcaagtcgactcatcagtcggtaaccgaaaaactccacgaactgtat
aacaacctgcacggcaacgagatggcagactccacggagccctaccacgcggacacgctg
ctgcacgccatccaggacgtaaacgccacctttgaaggcaaccagcagcaggacgcacac
gaattcctaatgtgcgtgcttaattgcatcagggaaacgaatcagtctttaatcaaggcc
attggcgagtgtcctgaggtcatcgcaaatgggtacatagccaacccggatgaagtcgac
tccggagagagccaggatcgcactgattccactgcgtcgcagaacgtgagctctggcaat
ggatcggtggcaactagtcaaataaccacgaccaaaacgtcgttcttctctcgcaaatca
aaaagaaaagacgaggtcaagtcatccaagtcgacgcgcgttcagtcgccgctcaaggat
aatagtcccacggcgggcgggttaaccggagcgggcacagcccatgccaccgccaacagc
ctgttctacctgaacacagttgatctcagcggcgccagcagcactagtggaagtgccagt
acgagtgccagtggcgttgttcccacaagtgtagcgttgccgacactaccgcaggctaca
aaatactccagtgacgacgaaatgaattcggccgccgtgctgaaggacaaaatgcgactg
gaggagcgaatacgggagctcaacctgaacttcttcagctccgacttcgagggcattgtg
gtgctgacgaccaagtgcctcagttgcgagacgatcacgcgacaaaagcagggcatgctt
gatatttctgtgccggtgccgatctctggatacgacaatgccgatctgcaggacaaaccg
agcacctacatacagaattcctgcattacgaaggagtatttccgcggcgagaataagtat
agttgcaaccagtgcaccggctacaccgaagccattcggtccatctcgtacgaggtgctg
ccccggctactggtcatacagctgaatcgtttctctggcggcatggagaaggtgagtacg
tacgtgcccacaaccttcacgctgccctgtttctgcgccacctgctgtgagctgggcgaa
ggcaacaagctgcacgtttacaagctgtacagcgtgatcacgcatgtgggagccacactg
acggtgggccactacatcgcctacacgtgcttcttggatctggccagtgactatgtcaac
tgtccgaaggatcgaaggaatacgatgacaaactcgcaaacgatgacatcgcaaacagtg
gcctccaatgaaaatgctgcgccaaacaatggaagcagctccgtggccagcactccagtt
attgcagccgcttcggctttggcctcctcaggcaacattttgatgaaaaagatgaagttc
ggccgcagcaaggcctccagcagcggtgatatgagcaagaatgttaagcaagttaatggg
accagcagcaagaacatcaccaatggaattggaaagctgagcatgaacaccacctgccag
ggagtcaactgctgtgccatgaggctctgctgcagccagcagacgagcggcagcaactca
gccagttgcagcgattttagcgaggaaacgctgcaaaacggaagcaacagcaatctcagc
tttggaggatcgggcagcacctatcccacaggctacggcagcacgggtcgtggtggtgtc
agagccaactacgcccacggaggtcctgatcccatttggtacatgtgcgacgacgacaag
atcaaggccatgacccaaagggagttcgaagagctgttatcccccactcggaagatcaca
ataacgccctatttgctcttttacgcgcgattcgatctgcagccgcataaggcgacaccg
ccgaagcctggatcatcgtcaacgcctccgccaccgtcgtcggcacagagttcgtggtcg
aatgaaaacatggccagcggctcgcataagatttga

DBGET integrated database retrieval system