KEGG   Drosophila erecta: Dere_GG11697Help
Entry
Dere_GG11697      CDS       T01060                                 

Definition
GG11697 gene product from transcript GG11697-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
der  Drosophila erecta
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:der00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MAATSPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIAS
LANKFPTVKIIGEEGGSDLNVCDDWLVNELDEGFLQQSCPTEWKDVKPEDFVIWVDPLDG
TAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYKQPDGEMGRTIWGLKGLGTGGFTAVP
APAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQNHAALVEKIPAEVR
AAVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacttctccggtgatcatgcgcgtcatggcgtcctcgatcagcaccgccaag
cgggctggcggaatcatccgcgacgtgctcaagaaaggcgacctaggcattgtggacaag
ggcaagaacgatccccagacggaggcagatcgctctgcccagcgctgcatcatcgcctcc
ttggccaacaagttccccaccgtgaagatcattggcgaggaagggggatctgatctgaat
gtttgcgacgactggctggttaacgagttggatgagggattcctgcagcaaagttgtccc
actgagtggaaggatgtcaagcccgaggacttcgtgatttgggtggatcccctggatggc
acagcggagtatacacagggacacgtggaacacgtgaccgtcttgatcggcatagctgtg
aaggatgctgctgtgggcggcatcattcatcagcccttctacaaacagcccgatggcgaa
atgggtcgcaccatttggggcctgaagggtctgggcacgggaggattcacggcggtgccc
gcgccagccggccagttcatcataaccaccactcgctcgcattccaatgccctgcatcag
caagccctcaatgcattcgcatccacggaagttctgaaagtcggaggcgctgggttcaaa
gtgctccagttgctggagggcaaggcccatgcctacgtctttgccacaccaggatgcaag
aagtgggacacctgcgcacccgaagccgttcttgaggcccaaggcggctgtctcaccaac
atcaacggcgagcactacgcctacaatgcggatgtggagcacgtgaatcgccagggagtg
ctggctagcctgggacagaaccatgccgcgctggtcgaaaagattcccgccgaggtgcga
gcggcagtgggagccaagtag

DBGET integrated database retrieval system