KEGG   Drosophila erecta: Dere_GG11916Help
Entry
Dere_GG11916      CDS       T01060                                 

Definition
(RefSeq) GG11916 gene product from transcript GG11916-RA
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MSQHTTQYVFNSKDDYNITLDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKGGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHRMHLMYRDLKPENILLDQRG
YIKLTDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICVSDYKMPSYFTPQLRSLVESLMQVDTTKRLGNSNEGATDVKGHPW
FQGVDWFGILNQEVTAPYMPTVSGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacactacgcagtacgttttcaactccaaggatgactacaacatcacccta
gacaacatgagtcgcgagttcgaagagcggtggaaccaccagacccagtcgccctacacc
aacctggagaactatataaccagggccgtgctcggcaacgggagttttggcactgtgatg
ctggtcagggagaagggtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgtacacaacgagaagcacgtcctgaatgccgcc
cgattcccgttcctcatctacctggtggactcgacaaagtgcttcgactacctctacctg
atcctcccgctggtcaatggaggtgagctgttcagttaccatcgcagagttcgcaagttc
aacgagaagcatgccagattctatgccgcccaggtggcactggcactcgagtatatgcac
aggatgcacctcatgtaccgggatctgaagccggagaacatactgctcgaccagcgcggc
tacatcaaactcacggactttggtttcacaaagcgtgtggatggccgcacctcaacgctg
tgtggaaccccggagtacttggcccccgagatcgtccaactccggccctacaacaaatcg
gtggactggtgggccttcggtatcctggtgtacgagtttgtggcagggcgctctcccttt
gccattcacaatcgagatgttatcctgatgtactccaagatctgcgtttccgactacaag
atgccctcgtactttacgccacagctgaggagtctcgtcgagagcctcatgcaggtggac
accacaaagcgtttaggaaactcgaacgagggcgccaccgacgtgaagggtcatccgtgg
ttccagggcgtggattggttcggcattcttaaccaggaggtcaccgccccctacatgccc
accgtttcgggtgccgaagatctgtccaactttgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaactgtttgcgaatttttaa

DBGET integrated database retrieval system