KEGG   Drosophila erecta: Dere_GG11917Help
Entry
Dere_GG11917      CDS       T01060                                 

Definition
(RefSeq) GG11917 gene product from transcript GG11917-RA (EC:2.7.11.-)
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 356 aa AA seqDB search
MGPQPEQAHMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGK
VQLVRERESGVYYASKQLSKDQIIKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGSLRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccagcctgagcaagcgcacatgcacttcagtcccaaggtggactacatcctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacactccgtcgccc
agcacgggactggatgactacgagatcaaggcgaccctcggatccggatccttcggcaag
gtgcagctggtgagggagcgcgagtccggcgtctactacgcctccaagcagctgagcaag
gatcagatcatcaagaccaaacaggtgagccacgtgatgagcgagaagaacgtgctgcga
tcgatgacgttcccgaacacggtcaacctgatagcctcctacaaggacttcgacagcctg
tacctcgtccttccgcttattggtggcggagagctcttcacctaccaccgaaaagtgcga
aagtttacggaaaagcaggctcgtttctatgctgcccaggtgtttttggctctggagtat
ctgcatcattgcagtttgctctatagagacctcaagccagagaacataatgatggataag
aacggatacctgaaagtcaccgatttcggatttgccaagaaggtggaaacccgtacgatg
actttgtgcggcaccccggagtacctgcctccggagattatccaatcgaagccctatggt
accagcgtggactggtgggctttcggggtactggtctttgagttcgtcgccggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgcgaggcggac
tataagatgcccagttacttcagtggatccctgcgccatttggtggaccatttgctgcag
gtggacctctccaagcgttttggcaacctgatcaacggcaaccgcgacatcaaggagcac
gagtggttcaaggatgtggagtggatacccctactcaatcagacagttaacgcgccctat
gtgcccaacatcagcaatcccgaggatatatccaacttcgacaaggtctctgacaagccg
cgccccaaggccaaaaccatgcgacacgaggaagccttcgcggacttttaa

DBGET integrated database retrieval system