KEGG   Drosophila erecta: Dere_GG11934Help
Entry
Dere_GG11934      CDS       T01060                                 

Definition
GG11934 gene product from transcript GG11934-RA
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
der  Drosophila erecta
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:der00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dere_GG11934
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG11934
Peptidases [BR:der01002]
 Metallo Peptidases
  Family M67
   Dere_GG11934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 424 aa AA seqDB search
MSKAVNNMNMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE
YEQFLASKEAERVKELERERERERERERERQRQKEREKAGSSGIPSLIPANLHVLIDEGN
QPSAPDMGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTTNAKPSFDRNQKPSY
NRTDSLLAGSLRLVHVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQ
QQGTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEAL
AIVCAPKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVI
DLRR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaacaacatgaacatgggcgacgtggagccgcaggagaggatgaag
cacctgtcgcactgcggcaacctgatcgaggtggacaagaacatgccagtcacgcggtac
taccgctctggcaccgagatgctgcgcatggccaatgtttacctgcgggagggcaaccac
gagaacgcattcatcctgtacttgcgctacatgaccctcttcatcgagaagatccgccag
cacccggattacggcagcgtcaaggccgaggtgcgggatataaacaggaagattaaggac
gagataatgcccacgacggagaaactgagggccaagctactaacgcactaccaaagggag
tacgagcagttcctggccagcaaggaggcggagcgggtcaaggagctggagcgcgaacgg
gagcgtgagcgggagcgggaaagggaacgtcagcggcagaaggaaagggagaaggcaggc
tccagtggcattccatccctcatcccggccaatttgcacgtgctcatcgacgagggcaac
cagccatcggctccggacatgggcctgcttgaccaggtggtctaccccaatgactttccc
acgggcgccaatcgcagcctgccgggatccggcctcctactgcccgccgccagcgaagca
gccgccgacaagactaccaatgccaagccgagcttcgatcgcaaccagaagccatcctac
aaccgcacagattctctgctggctggctccttgcgccttgttcacgtgcccggggacaca
atggaggtctttctgaagctggccctcgccaacacctcgaagaacatcgagacgtgcggc
gtactggctggtcatctgtcccagaaccagctgtacatcacccacatcatcacgccgcag
cagcagggaactccggacagctgcaacacgatgcacgaggagcagatattcgatgtgcag
gatcagatgcagctgatcacgctggggtggatccatacccatcccactcagactgcgttt
ttgtcctccgttgacctgcatacgcactgctcctatcagattatgatgcccgaagccttg
gccatcgtgtgcgcgcccaagtacaacaccactggtttctttatactcacgccgcactac
ggcctggactacattgcccaatgtcgccagtcgggctttcatccgcatcccaatgacccg
ccgctcttcatggaggcgcagcacatccgaatggacaaccaggccaagatcaaggtcatc
gacctgcggagatag

DBGET integrated database retrieval system