KEGG   Drosophila erecta: Dere_GG11962Help
Entry
Dere_GG11962      CDS       T01060                                 

Definition
GG11962 gene product from transcript GG11962-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:der01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:der01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:der00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:der00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:der00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MPPGVPLKLNRNGIQCISSASLLQRLPYQRNHHTTATMDQNRPTVGGVTAEVLKTVVSQA
LLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCTDSNSDTMSRKFCVGGNWKMNGDQKS
IAEIAKTLSSASLDPNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISP
AMLKDIGADWVILGHSERRAVFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTN
EVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGKTATPDQAQEVHAFLRQWLSDNISKEV
SASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaggagtgcccctcaagctgaataggaacggtatccagtgcatttcatcagca
tcgcttctccagcggctcccatatcagcggaaccaccataccaccgccaccatggatcag
aaccgacccactgtgggtggtgtgacggcggaggttctaaaaaccgtcgtttcgcaagct
ctgctgggcaaattcacagctgttttcccaaagcttttcaagtgccagtggaagacctac
gaaggtcaaaagaagttctacgcaaatttcagcaccgactgcaccgacagcaacagcgac
accatgagccgaaaattctgcgtgggaggcaactggaagatgaacggcgaccagaagtcc
atcgccgagatcgccaagaccctcagctcggcctccctggaccccaacacggaggtggtc
attggctgcccggccatctacctcatgtacgcccgcaacctgctgccctgcgagctgggt
ctggccggccagaatgcctacaaggtggccaagggcgccttcaccggcgagatttcgccg
gcgatgctgaaggacatcggcgccgactgggtgatcctgggccactcggagcgtcgcgcc
gtcttcggcgagtcggacgccctgatcgccgagaaggccgagcacgccctggccgagggc
ctcaaggtcatcgcctgcattggtgagaccctggaggagcgcgaggccggcaagaccaac
gaggtggtggcccgccagatgtgcgcctacgcccagaagatcaaggactggaagaacgtg
gtggtggcctacgagcccgtctgggccattggcaccggcaagaccgccacacccgatcag
gcccaagaggtccacgccttcctgcgccagtggctgagcgacaacatctccaaggaggtc
tccgccagcctgcgcatccagtacggtggatccgtgaccgccgccaacgccaaggagctg
gccaagaagcccgacatcgatggcttcctggtcggaggcgcctccctgaagcccgagttc
gtggacatcatcaacgcccgccagtaa

DBGET integrated database retrieval system