KEGG   Drosophila erecta: Dere_GG12174Help
Entry
Dere_GG12174      CDS       T01060                                 

Definition
GG12174 gene product from transcript GG12174-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dere_GG12174
Peptidases [BR:der01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dere_GG12174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 654 aa AA seqDB search
MAAATWSWLLAPFLLLHWASAGAGGGAGGSGAGLSGPSVFTSSFLVRFRRGVDNAFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEANRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARNNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHAVPPRYHCEAGELTQPQAIIMGRSLFWEIKTDACKGTDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacatggagctggctgttggccccattcctgctcctccactgggccagt
gcaggagcgggcggcggagcaggcggatcgggagcgggactgagcggcccctccgtcttc
accagctccttcctggtgcgcttccggcgcggagtggacaacgcgtttgcccatgatgtg
gccgacaagtacggcttcgacaacctaggcccgctggtcggcgccgatggacacgagtat
cacttcaagcaccggacccttccacatgcccgctccaggcggagtctgacgcacacacgg
gccctcaagagccatccggcggtgcatacggccgtgcaacagccgggattcaagcgggtt
aagcggggcctgcgaccggcggtgcccgccatccacggcatgaagttcgacctgaaagtg
ggcgaggccaatcggattgacgaggagcccactgacccctactttcccatgcagtggtac
ctcaagaacacgggccagaatggcggcaaagtcaggctggatctgaatgtgcaggctgcc
tgggcccaggggatcaccgggaagaatgttacgacggccatcatggatgatggcgtggac
tacatgcatccggatctgaaattcaattataacgccgaggccagttatgacttcagcagt
aacgatccctttccatatccccgatacaccgacgactggttcaacagccatggaactcgt
tgtgccggcgaagtggctgctgccagaaataatggaatttgcggcgttggcgttgcttat
gacagcaaaatcgcaggcattcgcatgctggatcagccgtacatgacggacctaatcgag
gccaactccatgggccacgagccgcacaaaatccacatctacagcgcctcctggggtccc
accgacgatggcaagaccgtggatggtccccggaatgccaccatgcgagcgatagtccag
ggcgtcaatgagggacgaaatggcctgggcaacatctatgtttgggcatccggcgacggc
ggcgaggaagatgactgcaactgcgacggctacgccgcctccatgtggaccatttccatt
aacagtgccattaacgacggccagaacgcccactacgacgagagctgcagctccacgctg
gcgtccacattcagcaacggagccaaggaccccaacacgggcgttgccaccaccgacctc
tatggcaagtgcacgaccacccactcgggcaccagtgcggcggcgcccgaagcagcgggc
gtctttgccctggccttggaggccaatccgcagctgacttggcgggacatacagcatctc
acggtgctgacatcgaagcgcaactcgctgttcgatgccaagaaccgattccactggaca
atgaacggcgtgggcctggagttcaaccacctattcgggttcggagtgctggacgccggc
gccatggtcacactatccaagcagtggcatgcagtgccgccgcgctatcactgcgaggcg
ggcgagctaacccagccacaggccattattatgggccgttcgctgttctgggagatcaaa
accgatgcttgcaagggcaccgacacggaggtcaactatttggaacatgtgcaggcggtg
atctcggcaaatgcctcacgtcgcggggatcttgagctcttccttacatcgccaatgggc
accaaatccatgatcctgtcgaggcgcgccaacgatgatgaccaccgcgatggcttcacc
aaatggcccttcatgaccactcactcgtggggcgagtatccgcaggggacctggaaactg
gaggctcgcttcaattcgccccaaacccgacacggcaatctgctggaatggtccttggtc
ctgcatggcaccaaggaggcgccctaccgcaccctgcacccctcgtcgccgcactccaag
ctggccattgtgaagaaggcgcacgaggacaagaagatgaagtag

DBGET integrated database retrieval system