KEGG   Drosophila erecta: Dere_GG12238Help
Entry
Dere_GG12238      CDS       T01060                                 

Definition
GG12238 gene product from transcript GG12238-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
der  Drosophila erecta
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dere_GG12238
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dere_GG12238
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dere_GG12238
  Exosomal proteins of breast milk
   Dere_GG12238
Glycosaminoglycan binding proteins [BR:der00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dere_GG12238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 435 aa AA seqDB search
MGTMILRMRNRAGERWQTNYFDTQMPLPSSGLMSPGLLPILDEQHGRQEPFERHYLAHGP
STVEQQLLRLQPDYKLLYSAEHHTYFHLHTLLPQDNANRQTGASQSEQASPHRRLFQQVV
GNTLTAAFGLNVMDKGDQEQKEQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNEN
ANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAG
MRLEDLQLIGFSMGAHVAGLAGKHMQSGRLRMIRALDPALPFFRYAKPKERLTTEDADYV
EVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQETGFLS
QGCPAGEWQQLTRFHRCPNDTGVVQTMGGDLANVSPEFLAQRQGVYYFQTNDQPPYVLAQ
NASSNRTAHIKKKKK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaatgattctgcggatgagaaatcgggccggtgagcggtggcagacgaactac
tttgacacacaaatgccactgccgtcatctggcctaatgagtcccggcctgctgccaata
ttggatgagcagcatgggcggcaggagccatttgagaggcattacttggcccacgggccc
agtacggttgaacagcaattactacgcctgcagccggactacaaattgctgtacagcgcc
gagcaccacacctatttccacctacacaccctgctcccgcaggacaatgccaaccgccag
acaggagcatcgcaatccgagcaggcatcgccacatcgccggctgttccagcaggtcgtg
ggcaacacactgaccgccgcctttgggctgaatgtgatggacaagggcgaccaggagcag
aaggagcagttcaccagcgaaccggtgaacctctacgatgccgcctcgttgcgccggtct
cgcttcagtcccttcaatcccaccagaatcctcattcacggctggttgggcaatgaaaat
gccaacatgtacaacgagctgttgccagcttattttgatctgagaaatggcaactacaac
atcttcaccgtggactggggacgtggagccatagcggactatataacggccagctatagg
gtcaagccggtgggtcaggttttggccaagttcgtggactttctgcaccaggaggcgggc
atgcgtctcgaggatctccagctcatcggattcagcatgggcgcacatgtggcgggactg
gcgggaaagcatatgcagagcggtcgccttcggatgatccgagctctggatccggctcta
cccttcttccggtacgccaagccgaaggagcggctgaccaccgaggatgccgactatgtg
gaggtgctgcacaccagtgtgggcagctatggatttgatcgacctgtgggccatgtggat
ttctatgccaattggggcagccagcaaccaggctgcttttggcatgaatgcagccattgg
agagcatttatgctgtttgccgagagtctagcaagggatcaggaaacgggcttcttatcc
cagggctgtccagctggtgaatggcagcagttgacccgattccatcgctgcccaaacgac
accggagttgtacagaccatgggcggggatttggccaacgtgtcgccggagttcttggcc
caaagacagggtgtctattatttccaaacaaacgaccagccaccctatgttttagcacaa
aatgccagctcgaataggacggcacacataaaaaaaaaaaaaaaataa

DBGET integrated database retrieval system