KEGG   Drosophila erecta: Dere_GG12313Help
Entry
Dere_GG12313      CDS       T01060                                 

Definition
GG12313 gene product from transcript GG12313-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dere_GG12313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 332 aa AA seqDB search
MKRLTERVHHEEQESEEVVWVKREDTRCAGKLPIVFSRNYAVRFGGLERLHPFDAAKGKH
IHKLLCSELQLDDGSFYEPTELTKDQLRRIHTRDYLKSLRWSMNVACIAEVPRSYLRPMR
FQAAGSILAGRLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRR
IMIVDLDAHQGNGHERDFNNVAAVYILDMYNAFVYPRDHVAKESIRCAVELRNHTEDAFY
LRQLKRCLMQSLAEFRPDVVIYNAGTDVLEGDPLGNLSISAEGVMERDRLVFSTFRTLGI
PVVMLLSGGYLKASAGVIADSIVNLRLQGLLN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctgactgagcgagtgcatcacgaggagcaggagtccgaggaggtggtctgg
gtcaagagggaggacacacgctgcgccggcaagcttcccatcgtattctccaggaactat
gcggttcgctttggtggccttgagcgcctacatcccttcgatgcggccaagggcaagcac
attcacaagctcctctgctccgagctgcagctcgacgacggcagcttctacgagcccacg
gaactgaccaaagaccagctgcgtcggattcacacaagggattaccttaagtccctgcgc
tggagcatgaatgtggcctgcatcgcggaagtgccgcggtcctatttgcgtcccatgcgc
ttccaagcagccggttccattttggccggtaggctggcgttggattatggttgggccatc
aacctgggcggtgggttccatcactgctgctcgtacagaggcggtggtttctgtccgtat
gccgacatctcgctgctcatcgtcaggctgttcgagcaggaacctttccgggtgcgccgc
atcatgattgtggacctggatgcccatcagggcaacgggcacgagcgggacttcaacaac
gtggcagccgtctacattctggatatgtacaatgcctttgtgtatccgcgggatcatgtg
gccaaggagagtatccggtgtgcggtggagctgcgcaaccacactgaggatgccttctac
ctgcgacaactcaaacgctgcctgatgcagtccctggccgagttccgtccagatgtggtc
atctacaatgcgggaaccgatgtcctcgagggggatccattgggcaatctgtctatttcc
gcggagggcgtcatggagcgggatcgcttggtgttcagcacattccgcactctgggaatt
ccggtggtaatgctgctgagtggtggctacttaaaggcatccgcaggggtaattgcggat
tccattgttaatcttcggcttcagggattgctaaactag

DBGET integrated database retrieval system