KEGG   Drosophila erecta: Dere_GG12328Help
Entry
Dere_GG12328      CDS       T01060                                 

Definition
GG12328 gene product from transcript GG12328-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
der  Drosophila erecta
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dere_GG12328
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dere_GG12328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MTTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGLPGANTLELVEELKLEVTPIRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKAVLRDLVTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGALISRFEKNKTKDTKDGLFAEGQPKLYAQALKEKWAMYGLQG
GLENLPKAMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVDHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEGIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccgtgctgggaggcggactgagtggactgtccgccggatactacctgttg
cggcgattcggaaagccgctgaccatctacgaggcatcgccccgtgtgggcggatgggtg
cggtcggagaatcggaaggatcgcaatttcatcttcgagagcgggccgcgaaccatacgc
cccgtaggattgccaggagccaatacgttagaactggtggaggagctgaagctggaggtg
actcccattcgacgcagtcatgtggcagcccgcaaccgaatgctgtatgccaagggacag
ctctgcatgctgcccaacagtcctaagggtctcttcggcgtcctgcctcccttcacgaag
ccgctgtacaaagcggtgctccgcgatctggtcacagcaagcaaaaaggccaaactggag
gatgagagcatctacagcttcgcagagcggcggtttggcaaggagatagctgactacgcc
atcagccccatgatctgtggtatttgcgccggagacgcgcgcgagataagcgtgcgcttc
ctgatggagggactctttgaaaaggagcagaagtatggaggagtgcttaagggcgcactc
atttcccgcttcgaaaagaacaagaccaaggacaccaaggatggactatttgctgaggga
cagcccaagctgtatgcgcaggcgctgaaggagaagtgggccatgtacgggctgcaaggc
ggactggagaacctgcccaaagctatgcgaaagtatctgggtgagcgggatgtcaacgtg
cagcttagcaacgagtgccgaaatctgacctttagcagctctggcgttcggatgaacatc
aaggatgccgaagtgccggtggatcatgtggtcagctccctccctgcctacaaactggcg
cctctggtaaagcagcagcatccctcgctgagcgcccaacttttgagcattccttacgtg
gatgtgctggtagtaaacatgcagttcccgggcaaactactgaagcaggacggttttgga
ttgctagtgccgccagtggaaaagctgcctctactgggcgttatcttcgacagctgctgc
ttcgacatgggcgagaacactgtgcttaccgtgatgatgggtggacattggttcgaccag
tggttcggcgatcgtcccagccccaagcagatccttgacttggccaccagtcatgtgcag
aaaatgctgcagatccgcgaggaacccaaattcagtcgagtgcacacgctgcacaagtgc
attccgcagtacactgtgggccacaagcggcgtgttgaggccattcggaactatatcaag
acttacaaactgccactgtccgtctgcggagctgcctacgatggcgtgggcatcaacgat
gttatcctgtccgcccggcgacaggtggagggcatacccttgtcttaa

DBGET integrated database retrieval system