KEGG   Drosophila erecta: Dere_GG12331Help
Entry
Dere_GG12331      CDS       T01060                                 

Definition
GG12331 gene product from transcript GG12331-RA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG12331
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG12331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3902 aa AA seqDB search
MCEVCADFQNLLELYEVRVASSDLKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDTKNYD
RFNLVVQSLICLTVQHLKHIDHLIDNYKRLTASAAQVVAQAQQQREQQRDEASAQAEGKD
SSAPAEEPKKEEPSGSSGEEAQGSGDGPAKKPPVGPCTPPPPQTANSQHKSHLQYTEEPW
ILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALICDLHDNDLPIYL
LRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTAAVSNVKLWLNYHCNTQLFVPLRSRI
LQYMCKLSDQSLRSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKYFTSTTLTMRLA
GMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENHIVQHLFGPNLHVEIVKQAHVL
LNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPSLVKNLAPRPAMHLYSLLCRMDPK
EHTEQSIYIASALTKLLWTRDCSRSQMNLMQDHLLGSNVTASSSDSGSIEGSNTEDDHVG
ADDSSIASGGGGGGVGNKSPIDGVTPCKQARHRRHICDPTTEKGKQLSAEDMGKVDIVNN
RIVNIIDNTSSEEELQSRAALELQLHRSRKKTSNKRRRQKANKQIILPHELVEIWDGAED
VPSSDDADGEADGDGEGELLADSDECSDGATSQLVPAAVLKHLQGEGPYIRAIETNINEL
LSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEELAQLVSSRANCPDVPPAFAAAAAA
MMVAQSAMALQKSGESNVAAAAAAVAAAAAATGTAQQTLVAMNRQASVAAAAAVVAAAKA
KSDSDVDLMEVASGGKQHHSPKASQGSSASGNTPVQPSFKLNDVCQPGNTLLWDLLQDDK
IGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLYNVANNRSVIVSLRLLPKLFASF
QQFRPSDTHSMTLWAERNHRMMQCFFNNIRHYARRHAEVLITQNGEQQQQQLGGQLYSHK
TQVSVRLQFLSSIFSTVGSPKSFRLTLEQLDALWEWLAHDPECADCYFSWLQAQAKGGDQ
HALGIEALQHLYLKKLPELRPEEFSMVALGLFQQLCSFARIAMAEYDKHSEQISASASAV
GMYHLWKIALRAQSNDVSLAAIQYINMYYMGQQLRLEKEFVSQCMENLVQAATALESIDD
ETALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSHSNLKNEGAGPPLRIVLQQ
AGLSEKSLLQMHACDLIADLKAEVSKWWESLQTGLAAPVLGLLLSDGPLRIITQGQELTS
DYDERSLGDAGFKDNQIVYVSLGGRGARRKESNLEHPSMLPPPPKECLPTVLLLQPKYFE
KLFCLMQTLGDMQPQASTVNPQHHTKAQLLSRRVWDILAMLPTNPHILDAFKSLVTDLSE
LEQMDAAGEEEQLATKRKQIKQKFRDLLDPNNLQKFMYSLHIVESLALTSSRRGESNGNV
AMGHPPEQVRVKKSSMGRRRNSNEQPPPPPPEVKMSKEQLCELEAPLTPTPSTGLQDVET
EASSSSGGDKENQPKQHSKRQKKGDTFEQEKERPVGCSTPPSPTPPPPALSVMERGDNKW
SEAFVKCGGLRHLYEIFSEGQLQQSAHPKELALNEWRHDCLASLLRILWLLGFEELQSAD
AHVLMSRPHPFMLQLMEVPECLTRLSSILNDEVHQQHQASSANPLVFPYQFQHLRTGFWG
RAQLIQFAMNILVSFVHASAEARRLLWAPTGTDHCRWLQKFILEDPEPAVRREICAGLYR
ICLGNAHSYRLLLAPLLHKLIALLPLAEQMSSGTQPTQFLLSEEGKDPYGPACRDYFWLL
ARLVDTLSPEMVAEEHIDIEMLCESISQSILTREYYELRHGYQDDGLVGLLNLMSNLIKY
DTTFKYTPKALSFIEQLIGFLFDMPSPADRQKPKCKSASSRASAYDLLVELCRGCATNYA
YLHGRLLAQHKSGPKQPYPWDYWPRDEGRSECGYVGLTNLGATCYMASCVQHLYMMPQAR
AAVLRVPPTAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDM
AEFFIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMR
NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML
KEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQRENEGADGGGDGNDNEKAEATLD
ADIEECYEYELVGVTVHTGTADGGHYYSFIKERTKTSYHPHERWFLFNDAEVKPFDPSQI
AAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYERRLPEHLQRRHSELLVTPTPSP
TVEEKSEAEEPTKMETSASEIKADVDVEAEDEEKDKEKPAKTDTESKETPTKEEVAEVKA
KQDEPEKNEVGSQSIEGEKKSETDKKPTEKTIVSTEEEKQPTANCDNHKPSNNSHNKASN
DQQPSTSKAAQKLQLFRPLLNKELEDWIWQDNRQFLQDRNIFEHTYFNFMWQICGHIPQS
LISETDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASQEACEWFLSHMSLE
PYWPVQVLIQCPNQMVRQMFQRLVIHVIQQLRASHADLYLDVETDEDDKELIGQASCVTR
FIGSLISLLEHGARANLRHLSEYFGLLCEFSRMGDEEAMYLLRIGILKSLVDFYLGHKQT
DSIDISSDNEDNSSDEALSVEKMRPASLDKMIALCASLVERSRGPDFRLRLSPKDFTAIA
GGKGFPFLYQQIKDGINPHQTKHLIHALCRWDERLATQIIGMLFASVTKHTELCAPFFKL
LTLLTETQGGPVGLPCFTQLILPRMWDAAEYCPQSVLDWLSLQATKNKIAHAWILQSAEK
WLEQFLLAHDNTRVRNAAAFLLVALVPSQPFRANFRAHSQHKLLALNPHSYRDINSDAQA
VLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMIGSYMRSLWELFHPRLSEP
SVPAHHNKHALLTFWHHSLVDCPENAAQVANCPEITRNIAFNYILADHDDAEIVTYNRSM
LPAYYGLLRLCCEQSRALTRQLSQHQNLQWAFKNITPHPTQYAAAVDELFKLMALFATRH
PDASEQEKLDVTQFRRAVIVSYTSSLDARVSWSTLISALKILVDNEEDRTMVIFNGGIEM
CFEALHTLHSMHHEATACHVAGDLFDLLGEMLLLLATLRTRTDSPAQKKQQQQQQQLEQQ
LQLQQQQMLQKQQQQSQSQTQTPQTPQQKEKQLQQQMQQHLQLQQLQQMQFQQQHFLRQQ
HQHSALAKALPDAVKRLATLLNTFNSPEISRMALEVLKELVRNPSLETISILAPILINCH
LSVANAPNAIGPLGPYFPRRGAKHTPWPLGAKNSPRPPRPMVQMCIALAELTPRGLDADY
DVQVESFYRPYHDFIDVMMRMCVNTGTLNDTLVKLQCLVAIESTPLHFTYFPKFWVGIHN
NALTHKYVELLVKNQLLVEYLHNVLRDERSMLKDACVREFLELYYHKVAAQLPVARMIYT
INYGMHSKDDIDELCGDLFAIRIIAQATGVPASVRKELRGSLRALQNKSERFRKESERDP
FPNKKQKRDSQKVKEKDHPQPEGEKDTSTDNDKPADVSMESSGNSEQVTDSTKPPTPAGS
DDEQMEKTSIPSSDDETELEDELQPTPKRNKKASNKKTAQDRLNEEREKRLITLITMESY
IQSIFAILKRDACVPSSGATKEPSEEPCGEASTSAAAAVKLSRPKGACTPPEPMAAANDA
RCKMDTETEAEEQSPKPSHTNGGQQNESPPAATSADTAPANPSPAPTAAVASTSQAASPT
QI
NT seq 11709 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaggtgtgcgccgacttccagaatctcctggagctgtatgaggtgcgcgtggcc
agctcggatctcaaattccagctgctgctgaagagcgagatcgagaccaccttcaactac
atccagtcctggccgcagcgtcagtgcatgtgcctgtaccgggacaccaagaactatgac
cgcttcaatctggtagtgcagtcgctcatctgtctgacggtgcagcacctaaagcacatc
gaccacttgatcgacaactacaagcgactaacggccagtgctgcccaggtggtggcccag
gcccaacagcagcgagagcagcagcgtgacgaggcgtcagcccaggcagagggaaaggat
tcatccgcaccagcggaagaacccaagaaagaggagccatctggatcctcaggtgaggag
gctcagggctccggcgatgggccagccaaaaagccgccagttggcccctgcactccccct
cctccgcaaacagccaattcgcagcacaaatcccacctgcagtacacagaggagccctgg
atcctgcccgaagtagaaaagctactggtgctcgtctcaaaggtgttcttgctcaacttc
ccgctgtacatcgcccacaagcatggcatgcactctcggctggacgacctgcaggctgag
gaggcccaccatctggccctcatctgcgatcttcacgacaacgacctgcccatctatctg
ctgcggaacgtgagcctgttctgcaactcgggcggctttggcgccatgtcgctgtgcttc
gaacaccccgatctgccagtgtccaccgctcactcgatgaccgctgccgtctcgaatgtg
aaactttggctaaactatcactgtaatacccagctcttcgtgccgctgcgcagtcggata
ctgcagtacatgtgcaagctgtcggatcagagcctccgatctgccgccacccgcgcgatg
gccgactttgtgtggtcttctatgcgggacccgctggatgtggctgtcaacttcgatacc
gaaggattggcactggcctttaagtacttcacatcgaccacgctgaccatgcgactggca
ggcatggcccagatcaacgcacacattaatctatttaatgagatatgcaccaccgaaacc
gtcaacgaagtggagctgttcggacagcgcatcgcaaactggttgaccgaaaaccatatt
gtgcagcacctgtttggtccgaatctgcacgtagagatcgttaaacaggcgcacgtgctg
ctcaactttttggcggtggagaaccagatctccgaagaggacatcaagctgatctggcaa
gccacccagctgaaacactgctcaaagacgatcttcgacatcctgccttcgctggtgaag
aacctggcaccgcgcccggccatgcacctttactcactcctttgccgcatggatcccaag
gagcacactgaacagagcatatacatcgcctcagcgctcacaaaactgctgtggactcga
gattgctctcgcagccaaatgaacctaatgcaggaccacctgctgggttcaaacgtcacc
gcctccagctctgacagcggcagcattgagggcagcaacacagaggacgaccatgtgggc
gccgacgatagtagcattgccagcggtggaggcggcggaggtgtcggtaacaagagtcca
atcgatggagtaactccatgcaagcaggcccggcacaggcggcacatctgtgatcccacc
actgaaaaaggaaagcagttaagcgccgaggatatgggcaaagtggatatagtaaacaac
cgcattgtgaacattatcgacaacacaagcagcgaagaggagctgcagtcgcgggccgcc
ctggagctgcaactgcatcgcagccgcaaaaagacgagcaacaagcgacgtcgccagaaa
gccaacaagcagatcattctgccccatgagctggtcgagatttgggacggagctgaagat
gtgcccagcagtgacgacgcagatggcgaagccgatggtgatggcgagggcgaacttcta
gcggacagtgacgagtgcagcgatggcgcaacgagtcagctagtgccggcagcggtgcta
aagcatctgcagggagagggaccctatatcagggccattgagaccaatatcaatgagctg
ctcagtggcgcggagaacgatggcagctactcctccccgatgagcaacaaatccgagaag
aatctggctgattttgatgacgaggacgtgtcgccttgcgaggaggagctggcccagctg
gtcagctcccgcgccaattgcccggacgttccaccagcctttgcagctgcggccgccgcc
atgatggtggctcagtcggcgatggcccttcagaagtctggggagtcgaatgttgctgct
gctgccgctgctgtggccgctgctgcggcggctaccggtactgcccagcaaacgctggtg
gcgatgaaccgtcaggccagcgttgctgcagccgccgccgtggttgctgcggccaaggca
aagtcggactctgatgtggatctgatggaggtggcttccggcggaaaacagcaccattca
ccaaaggcgagccagggcagctctgcgtccggaaatacaccggtacagccctccttcaag
ctaaacgatgtgtgtcaacccggaaacacactgctctgggatctgcttcaagacgataaa
attggccaactgggagaatctctggctttggaggcggagaaggctctggccactctcctg
tgtttcagcatggaccgccagctgcgaacgaaatttatcgagggttgcctgtataacgtc
gccaacaaccggagcgttattgtcagtctgcgactgctgcccaaactgttcgcctcgttc
caacagttccgcccctcggacacacactcaatgacgctgtgggcagagcgaaatcatcgc
atgatgcagtgctttttcaataatatacgacactatgcccgtcgccatgccgaggtactg
ataacccaaaacggagagcaacagcagcagcagctgggcggtcaactctactcccacaag
acacaagtttctgtaagactgcagttcctatcatcgatattctcgacggtaggatccccg
aaaagcttccgcctaacgctggagcagcttgacgcgctatgggagtggctggcccacgat
ccggagtgtgccgattgctacttttcgtggctgcaggcacaggccaaaggcggtgaccag
cacgctctgggcattgaagcactgcagcatttatatttgaagaaacttccagagctgcga
cccgaggagttctccatggttgcgttgggactattccaacagctctgcagcttcgcccgc
atcgccatggccgagtacgacaagcacagcgaacagatctcggcaagcgccagtgccgtt
ggaatgtaccatctgtggaagatcgccttgcgcgcccagagcaacgatgtctccttggcg
gccatacagtacatcaacatgtactacatgggtcaacaattgcgcctggagaaggaattc
gtttcccagtgcatggaaaacctagttcaagcggccacggctttagaaagcatcgatgat
gagactgctttgatgcgagtccagcgaggcctgctcctgctaaacacccatttggatact
ttccggcgtcgatatgcgtttcatctgcgacgctgggcaatcgagggcaaagggattgga
tcgcatagtaacctaaaaaacgagggagctggtccacctctacggatcgttctacaacag
gcaggactttcggaaaaaagccttttacagatgcacgcgtgtgacttaatcgccgacctc
aaggcggaggtgtccaagtggtgggagagcctccaaactggtctggctgctcctgtgctc
ggtctgctgctcagcgatggaccgctacgcattatcacacaggggcaggagctgacctcg
gattacgatgaacggagtctcggtgatgctggattcaaggataaccagatcgtctacgta
tccttgggtggacgtggggccaggcgaaaggagtccaatttggagcacccgtcaatgctg
ccgcccccaccgaaggagtgtttgcccacggtgctcctgctgcagccaaagtacttcgag
aagctattctgcctgatgcagaccctgggagatatgcaaccacaagcgtccactgtaaat
ccccagcatcacacaaaggcgcaattgctctcacgacgcgtatgggatattctcgccatg
ctgccaaccaatccgcacattctagacgcctttaagagtctggttacggacctaagcgaa
ctcgagcagatggatgctgccggagaagaggaacaactggccaccaagcgcaagcagatt
aagcaaaagttcagagatcttctcgatccgaacaacctgcaaaagttcatgtactcgctc
catattgtggagagtctggccctaactagttccagacgcggcgaatccaacggcaatgtg
gccatgggacatccaccagaacaggtacgtgtgaagaaatcctcgatgggaagacggaga
aatagcaacgagcagccgcctccaccaccgccagaggtcaaaatgagcaaggagcaactg
tgcgagctggaggccccactgacgcccactccctccactggcttgcaggatgtggaaacg
gaggccagcagtagcagcggtggcgataaagaaaatcaaccgaagcaacacagcaagcgt
cagaagaagggcgatacttttgaacaggaaaaggagcgcccagtgggttgctctaccccg
ccgtctccaaccccaccaccaccagcactttcggtgatggaaagaggtgacaataagtgg
agtgaggcgttcgtcaaatgtggtggtcttcgtcatctgtacgaaatcttcagtgagggc
caactgcaacaaagcgcacatccgaaggagctggctttaaatgaatggcggcacgattgc
ctggccagcctgctgcgcatcctctggcttctgggatttgaggaactgcagtccgcggat
gcccatgttctgatgtcacgtccgcatccgtttatgctacagttgatggaggtgccagag
tgcctgacccgactttcatcgatccttaatgacgaggttcaccagcagcatcaggcttct
tcggccaacccactggtgtttccgtatcagttccagcacttgcgcaccggcttttggggc
agggcccagctcatccagttcgctatgaacatcctagtgagttttgtgcacgcctcggcg
gaagcaagaaggcttctctgggctccaactggtaccgatcactgtcgatggctgcagaag
ttcatcctggaggatcccgaacctgcagtgcggcgtgagatatgcgctggcctttaccgc
atttgcttaggaaacgcacacagctatcgccttttattggcaccactgctgcacaagctc
atcgccctgttgcctttggccgagcagatgagctctggcacccagcccacacagtttttg
ctttccgaggagggcaaggatccctacggacccgcctgccgtgactacttttggctgctg
gccagattggtggatactctgtccccggaaatggtggccgaagagcacatcgacattgaa
atgctgtgcgaaagcatctcgcagagcattctcacccgagagtattatgaactgcgccat
ggttaccaggacgatggcttggtgggtctgttgaatctcatgtccaatttgatcaaatat
gacaccaccttcaagtacactcccaaggcgttatcctttattgaacagctgattggcttc
ctgtttgacatgccctcgccggcagatcgccagaagcccaagtgcaagtcggcgtcgtct
cgagcatctgcctacgatctactggttgaactgtgccgcggatgcgccacgaactatgcg
tatctgcatggacgtcttctggctcagcacaagtccgggcccaagcagccgtatccttgg
gactattggccgcgcgatgaaggcagatctgagtgcggctatgtgggcctgaccaacttg
ggagccacttgctacatggcctcttgcgtccagcacttgtacatgatgccacaggcgcga
gcagctgttttgcgagttccacccacggctgcccgtaagcatggaccaacgcttctggag
ctgcaacggatgtttgcctatcttctggagtcggaacggaagtcctacaacccgcgaagc
ttctgcagggtttaccagatggatcaccagccgctgaatacgggagagcaaaaggatatg
gccgagttctttatcgatttggtgtccaaactggaagatatgacgcctgacttgaagcac
ctggttaaaaggctcttctgcggatccttgagcaacaatgtcgtctccctggattgcggt
catgtttcccgcacggctgaggacttttacactgtacgctgccaggttgcagatatgcgc
aatcttcaggaatccctggacgaagtcaccgttaaggatacactggagggcgacaacatg
tacacctgctcgcagtgcggcaagaaagtacgagctgagaagcgggcctgcttcaagaag
cttccccagatcttgtgcttcaacaccatgcgctacaccttcaacatggtcaccatgctc
aaggagaaggtcaacactcacttttcatttccgctgcgcctgaacatgtgtcattatgtg
gagaagaccttgatgccgcagcagtacaaggaggagcgagagaggcgccaacgtgagaac
gaaggagcagatggtggaggcgatggaaacgacaacgaaaaggcagaggccactctagat
gccgatattgaagaatgctacgagtacgaactggtgggcgtcactgtccacacgggcact
gcggatggcggacactactacagctttattaaggagcggacgaagaccagttaccatcca
cacgagcgctggtttctattcaacgatgccgaagtcaagccgttcgatccgtcacagata
gcggcggagtgctttggcggcgagatgacgagcaaaacctacgactcagtgacggagaaa
tatctggactttagtttcgagaaaaccaactctgcttacatgctgttctacgagcgccga
ctgccagagcatctgcaacgccggcattccgagttgctggtaacaccaacgcccagtccc
actgttgaagagaaatccgaggcggaggagcccacaaaaatggagacgagcgctagcgag
atcaaggcagatgtggatgtggaagcagaggatgaggagaaagacaaggagaagcctgcg
aagactgacacagagtccaaggaaaccccgacaaaagaagaggtcgcggaggttaaagcg
aagcaggatgagcctgagaaaaatgaagtcggatcgcaatccatagaaggcgaaaagaaa
tcggagacggacaaaaagcccacggagaagacgatcgtgagcactgaggaggagaagcag
ccaacagccaattgtgataatcataagccaagcaacaatagccacaacaaagccagcaac
gatcagcagccttctacgtcaaaggcagcccagaagctacaactatttcgtccattgttg
aacaaggagctcgaggattggatttggcaggacaatcgacagttcctgcaggatcgtaac
atcttcgagcacacctatttcaactttatgtggcagatatgtggacacataccccaatca
ttaatatcagaaacggacgtcacctgcatggcagccaagttgtctgtgtcctttttcatt
gagacttttattcatgctaaggaaaagcccactatggtgccctgggtggagctgctgacc
aagcagttcaatgccagccaggaggcctgcgagtggttcctgtcgcacatgtcgctggag
ccctactggccggtccaggtgctaatccagtgtcccaaccaaatggtgcgtcaaatgttc
cagcgtttggttatccatgtcatccaacaattacgtgcctcacatgccgatctgtatctg
gatgtggagacagacgaagatgacaaggagttaataggccaagcctcttgtgtaacccgt
tttattggttcgctcatctcgcttctggagcacggtgcccgagcgaacctgcggcacttg
tccgagtactttggactgctgtgcgagttctcacgcatgggagatgaggaggccatgtac
ttgctgcgcatcggtatactcaagagcctggtggacttctatctggggcacaagcaaaca
gacagcatagacataagctccgacaacgaagataactcctcagacgaggcgctgtccgtg
gagaagatgcgtccggcctcgctggacaagatgattgctctgtgcgccagcctagtggaa
agatcaagaggacccgacttcaggctgagactctcgcccaaagactttactgcaatcgcc
ggcggcaagggttttccatttttgtaccaacaaataaaggacggcattaatccgcaccag
acaaagcatttaatacacgccctttgtcgctgggatgagcgcctggccacgcagatcatt
ggcatgctattcgcctcggttaccaagcacacggagctgtgcgcacccttcttcaagctg
ctcacactgctcaccgagacgcagggcggtccagtgggcctgccgtgtttcacccagtta
atcctgccccgcatgtgggacgcggccgagtactgtccacaatccgtgctggactggctc
tcgctgcaggccaccaagaacaagatcgcccacgcctggattcttcagtcagccgagaag
tggctcgagcagttcctgctggcccatgataacacgcgggttcggaacgctgccgccttt
ctgctggtggcactggtaccctcgcagcccttccgggccaacttccgcgcccactcacaa
cacaagctgctggccctcaatccacacagttatcgcgacataaacagcgatgcccaggct
gtgctgcaccaggtgataacgctgctcctgcgattgctgcgtcctgcgcgcgtctatgcg
gatatcggagcccatggcacgaccaagctgaccgcgtacttcaatctgctcagctattgt
atgataggttcgtacatgcgctccctgtgggagcttttccatccacgcctctcggagccc
agtgttccagcccatcacaacaagcacgcactattgaccttctggcaccactcactggtg
gactgtccggagaatgctgcccaggtggccaactgcccagagattacgcgcaacatagca
tttaactatatactggccgatcatgatgacgcggagatagtcacctacaatcgttccatg
ctgcccgcctactatggactacttcgtctgtgctgcgagcagagccgagcactcacccgc
caattgtcccagcaccagaatcttcagtgggcctttaagaacatcacgccacatcccacg
cagtacgcggccgccgtggacgagcttttcaagttgatggctctgttcgccacccgtcat
ccggatgctagtgaacaggaaaagctcgatgtgacccagtttaggagggctgtgatcgtg
tcctacactagtagtctggatgcgcgtgtctcctggtccacgcttatcagtgctcttaag
atactcgtggacaatgaggaggaccgcacgatggtgatctttaacggcggcattgagatg
tgctttgaggcgctgcacacgctacattccatgcatcacgaggccaccgcctgccatgtg
gctggagacctattcgatctcttgggcgagatgctgctcctcctagccacgctgcgaacc
cgcacagacagtcctgcgcaaaagaagcagcagcagcaacagcagcagctggagcaacag
ttgcagttgcagcagcaacagatgctgcagaaacagcagcagcagtcgcaaagccaaacg
caaacaccacagacgccgcagcaaaaggaaaagcagctgcagcaacaaatgcagcagcac
ctgcagctgcaacagttgcagcaaatgcaattccagcagcagcacttcctgcgccagcaa
catcagcactcggcgctggcgaaggcactgccggatgcagtaaagcgactggccacgcta
cttaacacctttaactcccctgagatcagtcgcatggccttggaagtgctcaaggagctg
gtgcgcaatcccagcctggaaaccattagcattctggcgcccattcttatcaactgtcat
ctgtccgtggcgaatgctcccaatgcgatcggtcctctgggaccgtatttcccgcgtcgc
ggagcgaagcacacgccttggccattaggcgccaagaactcaccccgtccaccgcgaccc
atggtacagatgtgcatcgctctggcagagctgacacctcgcggtctcgatgcggattac
gacgtccaggtggagtccttctaccgaccataccatgacttcatcgatgtcatgatgcgc
atgtgcgtcaacacgggtactctgaacgacacgctagtcaagctgcaatgcttggtggcc
atcgagtccacgccgctgcacttcacctatttccccaagttctgggtgggcatacacaac
aatgctctgacgcacaaatacgttgaactgctcgtgaagaatcaactgttggtggagtac
ctccacaatgtcctgagggacgagcgaagcatgttaaaggatgcgtgcgttcgtgaattt
ctggagctctattatcacaaggttgccgcccagctgccagttgcccgtatgatctacaca
atcaactatggtatgcactccaaggacgacattgacgagctgtgtggtgacctgttcgcc
atccgaatcattgcccaagccactggagtgccagcctcagtgcgcaaggagttgcgcgga
tctctgagggcactacagaataagagcgagcggtttaggaaggaatcggagcgggatcca
tttccgaacaagaagcagaaacgtgactcgcaaaaggtgaaggaaaaggatcaccctcag
ccggagggcgagaaagacacctcaacggacaacgacaaaccagcagatgtctctatggaa
tccagcggtaactcggagcaagtaacggacagcaccaaaccaccaactcctgctggcagc
gacgatgagcagatggagaaaacgtcaattccctcgtccgatgacgagacagagctggag
gatgagctgcaaccgacgcccaagcgcaacaagaaggcgtcgaataagaagactgcccag
gatcgtctcaacgaggagcgcgaaaagcgactgatcacgctgatcaccatggaatcgtac
atccagagcatttttgccatccttaagcgagatgcctgtgtgcccagctcgggagcgact
aaggagccgagtgaggaaccgtgtggcgaggcttccacttcggcggctgccgctgtaaag
ttgtctcgccccaagggagcctgcactccgccggagccgatggccgctgcaaacgatgcg
cgatgcaagatggatacggagacggaggcggaggagcaatctccaaagccgagtcacacc
aatggtggccaacagaacgaatccccgccagcggccaccagtgcagacactgcacccgcg
aatccttccccggctcccacggccgccgttgcgtccacgtcccaggcagcaagtccaaca
cagatttag

DBGET integrated database retrieval system