KEGG   Drosophila erecta: Dere_GG12369Help
Entry
Dere_GG12369      CDS       T01060                                 

Definition
GG12369 gene product from transcript GG12369-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:der04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSASITKKFHKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKALVRGTNIHVAIKKLARPF
QSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHAANASLENFHQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKR
ITAEEALAHPYLEKYAEPSVELTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLGDVK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtctataacaaaaaagttccacaagttggatataaaccgaacggaatgggag
atcccggatatatatcaggatctgcagcccgtaggatcgggagcttatggtcaggtgtcg
aaggctcttgtccgtggcaccaatatccatgtggccattaaaaagcttgccaggcccttt
caatccgctgtccatgcaaagaggacgtaccgtgagctccgacttttaaagcatatggac
catgagaacgtaatcggtctgctggacatattccatccgcatgccgctaatgcatcgctg
gagaacttccaccaggtgtacttggttacccacttgatggatgcagatctgaataacatc
atacggatgcagcacttgtccgacgaccacgtccagtttttggtctaccagatactccgt
ggcttgaagtatatccacagcgcgggagtgatccaccgtgatcttaaaccctcaaacatt
gccgtcaacgaggattgcgagctgcgcattttagacttcgggctggcacgtccaacggag
aatgaaatgacaggctatgtggccacgcgttggtatcgcgcccctgaaataatgctcaat
tggatgcactacgaccagacggtggacatctggtcggtggggtgcatcatggccgaatta
attacccgacgcaccctcttcccaggcaccgatcatatccaccaattgaacctaattatg
gagatgttgggcacgccacccgccgaatttttaaagaagatctcatcggaaagtgcgcgt
tcctacatccagtcccttccgcccatgaagggacgcagttttaaaaatgtttttaagaac
gccaatccgctggccatcgatttgctggagaaaatgttggagctggatgccgagaagcgt
atcacagccgaggaggctcttgcacatccctatctggagaagtatgcggagcccagcgtc
gagctgacctcaccaccatacgatcacagctttgaggatatggatttgcccgtggacaag
tggaaggagctgatctacaaagaggttaccaactttaagcctccaccatcgtttgctcag
gttctaggggatgtaaagtaa

DBGET integrated database retrieval system