KEGG   Drosophila erecta: Dere_GG12792Help
Entry
Dere_GG12792      CDS       T01060                                 

Definition
GG12792 gene product from transcript GG12792-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
der  Drosophila erecta
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dere_GG12792
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dere_GG12792
Enzymes [BR:der01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dere_GG12792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MWWSRKFASRSLRLHRLKSTGSTAPREPAQSLGIIGVPFAKGQGKQGVELAPDLLRQSSL
RQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVP
KIIEMTLDALHPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQ
GVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGILGSD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgcctcaaggtctctccgcctgcaccggctcaagagcacc
ggaagcacagctcccagggaaccggcgcaatctctaggcatcattggagtgcccttcgca
aaggggcagggaaaacagggcgtggaactggcgccagatcttctccggcagagcagcctg
cgtcaggtgcttcagagcagtcatgatggcctggtgatacgggactacggaaacctacag
tacgccgtagacgagccccttctccaacagcagcgtgtgcactaccaccacatccgaaac
tacgcggatttcatggcttgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gagaacacgcagtttttggccattggtggtgatcatgcgatcggcttcggatccgtggcc
ggacacctgcaacacacgccgaacttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcccgtatcctttctgttg
gaacagctccgtaacacctggcagcacgctggcctccaggaaatcgcgcccaactgcttg
cccaaggatcagttggtttacatcggactccgggacattgacccctacgaggcgttcatc
ctaaacaaagtcggaatacgctactatgcgatggataccatcgaccgggtgggcgtgccc
aagattatcgagatgacgctagacgccctccatccgcagaacaagatccacgtcagcttc
gacatcgacgccttggacagcaatgtggcccctagcacgggcaccgcggtgcgcggtggc
ctgacactccgcgagggaatcagcatcgtggaggcacttcgggacaccaagcgggtgcag
ggcgtcgatctggtggagatcaacccgaagttaggcagcgagcgcgacgtgcgcaccact
gtggagtccggcctggagatactgaagagcatgttcggctaccgacgctcggggcgctgg
agcaacatcgacaccggaattcttggcagcgattaa

DBGET integrated database retrieval system