KEGG   Drosophila erecta: Dere_GG12798Help
Entry
Dere_GG12798      CDS       T01060                                 

Definition
GG12798 gene product from transcript GG12798-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
der  Drosophila erecta
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dere_GG12798
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dere_GG12798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 304 aa AA seqDB search
MAQTEVLVFGSAIIDFISYTPRLPRPGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADTFGSDYLRHLREERINVDHVEQLADQTTGVAQIAVSDGGENNIIIVVGANNQLS
SSDVSAAEPLFREAKVLVCQLETPIEATLTALKSFRGVSIVNAAPAMADTPPELLQLASI
FCVNESEAALMTKMSDIGNVEQAEDAVGKLIEAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPIVPPEKVVDTTGAGDAFIGALAHNLARHPNGKLEDHIAAACAVASQSVQLHGTQSS
FPKA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaacggaagtgctagtctttggctcggccatcatcgacttcataagctacaca
ccccgtctgccgagacccggagaaacgcttcacgggcatcgcttccagactggctacggc
ggaaagggcgccaatcagtgtgtggccgccgcgcgccagggatcccgcacggctctggtg
gccaaactaggcgcagacaccttcggcagcgactacttgcggcatctgcgcgaggagcgg
atcaatgtggaccacgtcgagcagctggcggaccagacgacgggcgtggcccagatagcc
gtgtccgatggcggcgagaacaacattatcattgtggtgggcgccaacaatcagctgagc
tcatccgacgtctccgcggcggagccgctcttccgggaagccaaggttctggtctgccag
ctggagacgcccattgaggccaccctgactgccctcaaatccttccggggcgtgtccatt
gtgaacgcggctccggccatggcggacacaccccctgaactgctccagttggccagcatc
ttctgtgtgaacgaaagcgaagcggccttaatgacaaagatgagcgacattgggaacgtg
gagcaagccgaagatgcggttggaaagctgatagaggcaggtgccaacacggtgatcata
actttggggaaactgggagccgttttcggctccgccgactccaagggcgtgtgccagcat
gtggctgctccgattgtgccgcccgaaaaggtggtggacacgacgggggccggcgacgcc
ttcattggggccttggcccacaacttggcccgtcatccaaatgggaaactcgaggaccac
atagccgccgcatgtgccgtggcctcgcaatccgtgcagctccacgggacgcagtccagc
ttcccaaaggcctag

DBGET integrated database retrieval system