KEGG   Drosophila erecta: Dere_GG12810Help
Entry
Dere_GG12810      CDS       T01060                                 

Definition
GG12810 gene product from transcript GG12810-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
der  Drosophila erecta
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dere_GG12810
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dere_GG12810
Glycosyltransferases [BR:der01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dere_GG12810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 766 aa AA seqDB search
MAASVVKTPKCPRRGSVKDVAQSAPRTGPTSSKEANWNWWLLLATVFLVTFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNE
TRYQGMRYFCTTLGALVMPMGFDTVYDLTRSHEAALLAAAYLVFDVGLLTLNQYILLDPI
LLFFMMASVWGMVKVSKSTASGGSYGLRWWFWLFLTGTMLSCTISVKFVGLFVVLLVGLH
TATELWLILGDLGQPILESAKQLACRAITLIVWPILLYILFFYIHLSVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHHHLYPKGSGARQQQVTTY
THKDENNRWLIRLHNKHNLPKGKAQILRHGDIVRLTHMATKRNLHSHNEPAPMTKKHLQV
TGYGELGVGDANDAWRLLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQLPKWGFEQ
QEVSCNPNVRDKNSQWNVEDNEHKLLPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLCNAVVQQRRA
GFARSALQNQQAQRRDSQTVAQGEESEPSTTDVCSCCLPAEQKVLRPVPGGSLEPPNPAR
SLRAAAWLFVGWVLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMFNYIMLVLPKWIHHV
VLGLVLSILVYSFTAFSPLAYGMSGPLANEPNSTMHNLKWLSTWEF
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgttgttaaaactcccaagtgccccagacgagggtctgtcaaagatgtg
gcccaaagcgcacctagaacagggcccacgtccagcaaagaggccaattggaactggtgg
ctcctcctggccaccgtcttcctggtgaccttcgccacccgcttctataaggtcaccgaa
ccggaccacatatgttgggatgagacgcactttggcaagatgggcagctggtatatcaac
aggaccttttttttcgatgtccatccaccgctgggaaagatgctcattggcctctctggc
tacttgacgggctacaacggaacgtttccatttgagaagccaggcgacaagtacaacgaa
acgcggtaccagggcatgcgatatttctgcaccactctgggagctctggtcatgcccatg
ggattcgatactgtctacgatttgacccgttcccatgaagctgccttgcttgcggctgcc
tatctcgtttttgatgtgggtctcttgactctgaaccagtatatcctgctggaccccatt
ctgttgttcttcatgatggcctccgtctggggcatggtcaaggtgtccaagtccactgcc
tccggaggatcgtacggcctgcgctggtggttctggctcttcctcaccggcaccatgttg
tcctgcacgattagcgttaagttcgtgggcctgtttgtggtgctgctggtgggtctgcat
acagccactgagctatggctcatcctcggcgatttgggacagcccattctggagagcgct
aagcagttggcctgccgggccatcaccctgattgtctggcccattctgctctacatcctg
ttcttctacattcacctcagtgtccttaaccgcagcggcaacggagatggattctacagc
tcggcctttcagtccaggctgatcggcaactccctttataatgccagcatgcccagagat
gtggcctacggatcgctagtgaccatcaagaaccacaagacgggcggaggctacctgcat
tcgcatcaccacctgtatcccaagggatcgggcgccaggcagcagcaggtcaccacatac
acccacaaggacgagaacaaccggtggctaatcaggctgcacaacaagcataatctaccc
aagggcaaggcccagatcctccggcacggggacatcgttcgcctgactcacatggccacc
aagaggaatctgcactcccacaacgaacctgcgcccatgaccaagaagcatttgcaggtc
actggctacggcgagttgggcgtgggcgatgcaaacgatgcctggcgcctgttgattgtg
ggcggcaaggtcaacgaaacggtccacacggtcacttcccgcctcaaattcatccacctg
ctgcagaactgcgccctgacctccagtgggaagcagctaccgaaatggggattcgagcag
caagaggtgtcctgcaatcccaacgtgcgggacaaaaactcgcagtggaacgtcgaggac
aacgagcacaagttgttgcccagtgtgagcttcagcgtctatgcccccggcttctttgcc
cgcttcctcgaatcccacgccgtaatgctgcagggaaacgcaggactcaagcccaaggag
ggcgaggtcaccagcagaccctggcagtggccaatcaactacaggggccagttcttctcc
ggcagcagttaccgcatctacctgctgggcaacccgttaatttggtggagcaatctggtt
ttcctcgccctcttcgtcacggttttcctgtgcaacgcagtcgtgcagcaaagaagagcc
ggtttcgcccgatctgcgctccaaaatcaacaagcacaaaggcgcgactcgcagacagtg
gctcagggcgaggagagtgagccctcgaccacggatgtctgcagttgttgtcttccggcg
gagcagaaggtcctaaggccagttcccggtgggtcgctggagccacccaacccggcacgg
tccttacgggcggccgcctggctttttgtgggctgggttctccactatctgcccttctgg
gcgatgggccgggtgctctacttccaccactactttccggccttgatcttcaactccttg
ctaacaggcgtcatgttcaactacattatgcttgtgctgcccaagtggatccaccacgtc
gtcttgggactggttctctcgatcctggtctacagttttaccgcgttctccccactggcc
tatggaatgagcggtcctctagccaacgaacccaactccacaatgcacaatctcaagtgg
ctttccacctgggagttttag

DBGET integrated database retrieval system