KEGG   Drosophila erecta: Dere_GG12841Help
Entry
Dere_GG12841      CDS       T01060                                 

Definition
GG12841 gene product from transcript GG12841-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
der  Drosophila erecta
Brite
Protein phosphatases and associated proteins [BR:der01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dere_GG12841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MGLVGSRQLNHVELRAHQQATGLSAEQLEQLHTRFRSLDRQQRGYLTPTDLLRIPQLLLN
PLHRQIIDGFFPSREPSERMDFKQFVDTCSTFLVPQFGRGSARRRDGRVQKLRLLSKMFD
TRRSGCITRSDFRQIMRSIVNLNSSQKQEQEQERQVELSENRLPEVEAELLLLERQAFGS
PCDQISYVEFEQRLVSADVDGRLSIVKWLEDDGDDDDDDEDEVEAAMELSVGSGP
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggtaggaagtcgtcagctcaaccacgtcgaattgcgtgcccaccagcaggcc
accggactgtccgcagagcagctggagcaactgcacacgcggtttcgcagcttggatcgc
cagcagcgcggctatttgacacccaccgacttgctacgcattccgcagctcttgctcaac
ccgctccaccgccagatcatcgacggcttcttccccagccgtgagcctagcgagcgtatg
gatttcaagcagttcgtggacacctgctccacctttttggtgccacagtttggccgcggc
tcagcgaggcggcgcgacgggcgtgtccagaagctgcgcctcctgtccaagatgtttgac
acccgtcgcagcggctgcatcacacgctccgacttccgccagatcatgcgcagcatagtc
aatctgaactcgagtcagaaacaggaacaggaacaggaacgtcaggtggagctttccgag
aaccgtttgcctgaggtggaggccgagctgctactcctagagcggcaggcctttggctcc
ccctgcgaccaaatctcttatgtggagttcgagcagcgcctggttagtgcggacgtcgac
ggacggctgtcgatcgtcaagtggctggaggacgatggcgatgatgatgacgatgacgag
gacgaggtcgaggccgcaatggaactgtcagttggctcaggcccgtga

DBGET integrated database retrieval system