KEGG   Drosophila erecta: Dere_GG12850Help
Entry
Dere_GG12850      CDS       T01060                                 

Definition
GG12850 gene product from transcript GG12850-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dere_GG12850
   04150 mTOR signaling pathway
    Dere_GG12850
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dere_GG12850
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dere_GG12850
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dere_GG12850
Mitochondrial biogenesis [BR:der03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dere_GG12850
  Mitophagy factors
   Other mitophagy factors
    Dere_GG12850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 582 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPPPPPPVPQSSMDHQAPLATVTVGGGTAASSGTATPVPPVAGGTPSGTIPIRPH
PERIAPMRDRQLAMSVQTSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRA
MKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDD
VIMESLTPPPLSVSGVMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcgggcactacctgctgggcgccaccctgggcactggcaccttcggc
aaggtgaagatcggcgagcaccagatcacccgcgtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggacgttgtgggcaagatccggcgagagatccagaacctg
aagctcttccgccatccgcacatcatcaagttataccaggtcatctccacgccttcggac
atcttcatgatcatggagtacgtgagcggcggcgagctgttcgactacattgtaaagcac
ggaaagctgcaggagcaccaggcgcgccgcttctttcagcagattatctcgggcgtggac
tattgccaccgacacatgatcgtgcatcgggatctgaagccggaaaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctcgatggcgag
ttcctgcgcacctcgtgcggctcgcccaactacgcggcgcctgaggtgatttccggcaag
ctgtacgccgggcctgaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccctttgacgacgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttcccgattcccgagtacctcaacaaacaagtggtcaacctggtctgccagatg
ctgcaagtggacccgctcaagcgggccaacatcgaggagatcaagaagcacgagtggttc
caaaaggacctccccgcttacctcttcccctcgtccatcgagcaggactccaatgtgatc
gacacctacgctgtggcagaggtctgcaccaagttcggcgtcaaggagaccgaggttcac
aactccctgctcagcggcgatccgcacgatcagctggccatcgcctaccatctgattatc
gacaacaaacgcttcgccgatgacgcagccaaccaaataaacgagatcaacaactttttc
gtggccggctcgccaccaccgccgccgcctccgcccgttccgcaatcatcgatggaccac
caagcccctctggccaccgtgaccgtgggcggaggcactgcagccagctcgggcaccgcc
acaccagtgccccccgtggctggaggcacccctagcggcaccatccccatacgaccgcat
ccggagcggattgcgccgatgcgggaccgccaactggccatgtccgtgcagacatctggc
ggcggagccttcccggagaaaaccgcgcgtggcggtactcccatcaagcgcgccaagtgg
catctgggcatccggtcgcagagcaagccgaacgacataatgctcgaggtgtaccgggcg
atgaaggcactcagctacgagtggaagatcatcaatccgtaccacgttcgggtgcgcagg
cagaacgtgaagaccggcaagttctcgaagatgtcactgcagctgtaccaggtggatgcc
aagagctatctgctcgacttcaagtcgctgaccaacgacgaggtcgagcagggcgacgac
gtcatcatggagagccttactccgccgccgcttagcgtgtccggggttatgccgctgcag
ccgaccgggcatcacactatggagtttttcgaaatgtgcgccgccctgatcattcaactg
gctcgctga

DBGET integrated database retrieval system