KEGG   Drosophila erecta: Dere_GG12996Help
Entry
Dere_GG12996      CDS       T01060                                 

Definition
(RefSeq) GG12996 gene product from transcript GG12996-RB
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
der  Drosophila erecta
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dere_GG12996
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dere_GG12996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 176 aa AA seqDB search
MTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITP
MLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKVWYTVDKANEG
WQYSVGFINEDMIAAHLLPAKDDTIVLLCGPPPMINFACNPSLDKLGYHPDTRFAY
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacatctggagcagctcgagttgggggacaagatctcgttccgtggtccctcg
ggaaggctacaatatctcggcaatggcaccttctccatcaaaaagttgcgcaaggatccg
cccaagcacgtgaccgccaagcgggtcaacatgattgccggcggcactggcattactcca
atgctccaattggccagggaagtgcttaagcgcagcgataaggataagactgaactggcg
ttgctcttcgccaaccagagcgaaaaggacattctgctgcgtgccgagctggacgaactg
gcccagaagcatcctgaccagtttaaggtctggtacactgtcgacaaggccaacgaaggt
tggcagtacagtgttggcttcatcaatgaggatatgatcgccgcccacctgcttccggcc
aaggacgataccattgtgttgctttgcggcccaccacccatgattaactttgcctgcaat
ccgtcgctggacaaacttggctaccacccggacacccgttttgcctactaa

DBGET integrated database retrieval system