KEGG   Drosophila erecta: Dere_GG12996Help
Entry
Dere_GG12996      CDS       T01060                                 

Definition
GG12996 gene product from transcript GG12996-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
der  Drosophila erecta
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:der00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MTDIDFVPLAVGVVAVLAGALIVHYFLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIE
KENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYVDLV
VKVYFKDTHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKH
VTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQK
HPDQFKVWYTVDKANEESCVCPLNHAAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYA
PDEDTLCLLCGPPPMVNYTCIPGLERLGWQYSVGFINEDMIAAHLLPAKDDTIVLLCGPP
PMINFACNPSLDKLGYHPDTRFAY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacggatattgattttgtgcccctcgccgtgggtgtagtcgccgtactcgccggcgca
ttgattgtccactatttcctaaataaaaagtccacgaaaccacgccgggaacccaatcgc
accgcccgcctgcgcacgcttgtggatcccaacgacaagtacctgctgcccctcattgaa
aaggagaatctgagccatgacactaggagattccggtttggcttgccctccaagcagcac
gtccttggcctgcccgttggtcagcacattcatctgatcgccaccatcgacaatgagctg
gtgattcggccatacactccgatatcgtccgatgaggatgtgggctacgtggacctagtc
gtcaaggtgtacttcaaggacacgcatcctaagtttccggccggcggcaaaatgacgcaa
catctggagcagctcgagttgggggacaagatctcgttccgtggtccctcgggaaggcta
caatatctcggcaatggcaccttctccatcaaaaagttgcgcaaggatccgcccaagcac
gtgaccgccaagcgggtcaacatgattgccggcggcactggcattactccaatgctccaa
ttggccagggaagtgcttaagcgcagcgataaggataagactgaactggcgttgctcttc
gccaaccagagcgaaaaggacattctgctgcgtgccgagctggacgaactggcccagaag
catcctgaccagtttaaggtctggtacactgtcgacaaggccaacgaagaatcttgtgtc
tgccccttgaaccatgctgctatcaaacgcatgccgcgaatgggaaacgcgcgctttgta
gcctggtcctacaacactggacacgtgaacgatgacatgatgcagcagcatctgtatgca
ccggacgaggacacgctgtgcctactgtgtggtcctccgcccatggttaactatacatgc
attccgggcctggaacggcttggttggcagtacagtgttggcttcatcaatgaggatatg
atcgccgcccacctgcttccggccaaggacgataccattgtgttgctttgcggcccacca
cccatgattaactttgcctgcaatccgtcgctggacaaacttggctaccacccggacacc
cgttttgcctactaa

DBGET integrated database retrieval system