KEGG   Drosophila erecta: Dere_GG13030Help
Entry
Dere_GG13030      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
der  Drosophila erecta
Brite
Chromosome and associated proteins [BR:der03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dere_GG13030
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG13030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6556055
NCBI-ProteinID: XP_001982920
FlyBase: FBgn0105303
UniProt: P59781
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaccgacaagaaaaagaagcgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggtatttcgtctaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgcattgctgccgaggcgtctcgtctggctcac
tacaataagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cccggagagttggctaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system