KEGG   Drosophila erecta: Dere_GG13250Help
Entry
Dere_GG13250      CDS       T01060                                 

Definition
GG13250 gene product from transcript GG13250-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dere_GG13250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG13250
   00620 Pyruvate metabolism
    Dere_GG13250
   00640 Propanoate metabolism
    Dere_GG13250
Enzymes [BR:der01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dere_GG13250
Lipid biosynthesis proteins [BR:der01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dere_GG13250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 670 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADPEKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
LDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
KYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGFYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDKKLISDL
KKMVRDRIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgaaaaatcaatatatgatcccaatccggccatcagccaaaatgcctacata
tccagcttcgaggagtaccagaagttctaccaggagtcgctggacaatccggccgagttt
tggtctcgcgtggccaagcagttccactgggaaacgcccgccgacccagagaagtttctc
aagtataacttcaacatctccaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctactagatcgcaacgttaggaacggtctgggcgaccagata
gcctactactgggagggcaaccaccccgatgattattcccggggtcttacctatcgcaag
ttgctggaggaggtgtgtcgcttcgccaatgtgctgaaggatcatggaattcgaaagggc
gatcgtgtgtccatttacatgcccatgatactggagctaccgatcgcgatgctggcctgc
gcccgcattggagccgtgcactcgatcgttttcgccgggttctcaccggactcgctggcg
gagcggatgtttgattgcaaggccaagctgctgattacggcggatggagcctggcgtgga
gagaaacccctgtacctgaaggcactgtgcgacacggccttggagaaggtcgaggagatg
gggcactccgtggagaagtgcattgtggtgtctcacttaaagcgcgtgactccgtgccag
ctggatcatgtcgaggaggaaatcccgtggaccgatgaccgcgactactggtggcacgag
gagatggaggacaaggagccagcctgctaccccgagtggatggacgccgaggatccgctg
ttcatgctctacaccagtggctccactggcaagcccaagggagtgctccacacgaccgcc
ggatatctgttgtatgcggctacgaccttcaagatcgtatttgactataagccaggggat
atctactggtgcaccgctgatgttggctggatcacgggacacacctacgtggtgtacgga
ccgttggccaatggtgccacttcagtgattttcgagggcacaccattcttccctggaaac
gatcggtactggagcgtcattgacaagtataaggtcacccagttctacacagctccgacg
gcgattcgtgccctcatgaaattcggggagggtccagttctgaaacacaacctgagcgga
ctgaaagttttgggcagcgtgggtgagcccatcaacccggaggcctggctttggtactac
aagtacattgggaaggagcagtgctccattgtagacaccttttggcaaacggaaaccggt
ggtcatgtcattacacccctgcctggagcgacccccatgaagccgggatcggcttcgttc
cccttctttggtgtgaagcccactttgctggatgagtgcggaattgaaattaagggagag
ggcgagggctacttggtcttctcgcaaccttggccgggaatgatgcgcaccttgtataac
aaccatgaacgcttcgaggacacttacttctcaaagttcccaggtttctactgcactggc
gatggagcccgtcgcgatgctgatggctatttgtggatcactggtcgtgtggacgacatg
ttgaacgtgtccggtcatctgatgtccaccgccgaagtagagtcggtgctcacagagcat
cctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaaaggcgagtgtctc
tactgcttcattacgcccaacgaaaacgaggttttcgataagaagcttatttccgacctt
aagaagatggtgcgtgatcgcatcggaccttttgccatgccggatgtcattcaaaacgct
cccggactgcccaaaacccgctccggcaagattatgcgtcgtgtgctgcgcaagatcgcg
gttaacgatcgcaacgtgggcgacacatctaccttggccgatgagcaaattgtggagcaa
ctgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system