KEGG   Drosophila erecta: Dere_GG13311Help
Entry
Dere_GG13311      CDS       T01060                                 

Definition
GG13311 gene product from transcript GG13311-RA
Orthology
K03644  
lipoic acid synthetase [EC:2.8.1.8]
Organism
der  Drosophila erecta
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Dere_GG13311
Enzymes [BR:der01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Dere_GG13311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 379 aa AA seqDB search
MFGMLRALKTHVEAPIVVATRAVSTNAEKLEEIRERLAKGPNFQDFVQNPENSRSEWEKY
EGKLRREKGEEQRLRLPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGG
GEHGTQTATIMLMGDTCTRGCRFCSVKTARRPPPLDVNEPVNTATAIASWGLDYIVLTSV
DRDDLPDGGSKHIAETVREIKARNSNIFVECLVPDFRGNLECVETIANSGLDVYAHNIET
VEKLTPYVRDRRAHYRQTLQVLTEAKRFNPNLITKSSIMLGLGETDGEIECTLKDLREAG
VDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEERGNALGFLYTASGPLVRSSYKAGEFFI
TSILENRKKRQNATEIAKE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcatgttgcgagctttaaaaacgcacgtggaggccccaatagtcgtagccacc
cgtgcggtatcaacaaatgcggaaaagctcgaagagattcgcgaacgtctggcaaagggt
ccgaatttccaggactttgtccagaatccggagaactccagaagcgagtgggagaagtac
gagggaaagcttcgtcgcgaaaagggcgaggagcagcgcctgcgactgccgccgtggttg
aaaactaccattcccgtgggcaagaactacgccaaaatcaaggcccagatgcgcgagctc
aagctgtccaccgtctgcgaggaggcccggtgtcccaacatcggcgagtgctggggcggc
ggcgagcatggcacccagactgccacgattatgcttatgggcgacacttgcaccagaggc
tgtcgattttgttcggtaaaaacggctcgcagacctccaccgctggatgtaaatgaaccc
gtgaacacagccacggcaattgcttcctggggcttggattacattgtgcttacttcagtt
gatcgcgatgatttgccagacggcggatcgaagcacattgccgaaactgttcgcgaaatc
aaggcgcgcaactcaaacatctttgtggagtgcctggtaccagatttccgaggcaatctg
gagtgcgtcgagacgatcgccaacagcggcctggatgtttatgcgcacaacatagagacg
gtagagaagctcacaccctatgtgcgagataggcgcgcccactaccgccagacactgcaa
gtactaaccgaagcgaagcgattcaatcccaatctgatcactaagagttccattatgctg
ggacttggtgagaccgacggggagattgaatgcaccttgaaggatctgcgcgaggccggc
gtcgattgcgtgaccttgggtcagtacatgcagcccacaaataagcacctgaaggtcatc
gagtacgtcactcccgagaagttcaagcactgggaagagcgcggtaacgcattgggcttc
ctgtacacagccagtggaccgctagttcgcagctcctacaaagccggcgagttcttcatt
actagtatattggagaaccgaaagaagaggcaaaacgccactgaaattgccaaggagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system