KEGG   Drosophila erecta: Dere_GG13435Help
Entry
Dere_GG13435      CDS       T01060                                 

Definition
GG13435 gene product from transcript GG13435-RA
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
der  Drosophila erecta
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dere_GG13435
Enzymes [BR:der01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dere_GG13435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1849 aa AA seqDB search
MATPQVKDLVLRSPAGSSDVISFAWPLQIGHGQDKHDNGIDIIDTIKFVCDELPSMSSAF
EETNLHKIDTACYKTMTGLVDRFNKAVDSIVALEKGTSLPAERLNKFAHPSLLRHILQLV
YNAAVLDPDKLNQYEPFSPEVYGETSYELVQQMLKHVTVSKEDTFIDLGSGVGQVVLQMA
GSFPLKTCIGIEKADTPARYAERMDVIFRQYMGWFGKRFCEYKLIKGDFLVDEHREKITS
STLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSFCPLNFRITDRNLSDIGTIMHVS
EIPPLKGSVSWTCKPVSYYLHVIDRTILERYFQRLKTKGGNDHESVGTVRTTRDRAKREA
NVGQHHHNNHHSNSNNHANSNNHQREREQPNGATASAAHQQRHQSQSPADVSGAGIAVAA
SGQQAASKTRQQLQHQHNQQQRSLDMESSTESDGEATNGNGGNTTTATNTTSASNGPMTR
KVWSDWCSSKGKSSQSDDEENNNSNSNGGSIGGSIGGGSVGRQARAATQKKRKKLTRKAA
IASKSAAAAQREAEAAAAAAATVPSKESSSKEDPPRAASAGPGRKGRMKKGARGRKSLKI
VGLEALHKQTVLSTALDTMTKKLPAAPGTVDQQLTALLTENMAHTELDIPAAPQDTPYAL
QILLDVFRSQYTSMIEHMKSSAYVPQVQKQIAQEQERMARLKNRASQLDKQIKVLIDDSV
ALLKVRMNELGIHVNSPNDLIAQAKEIVGRHKDLQHTASRMRNEVTFYEGEQKLLLNKQL
KNLPEYQKLCGTVNGKVKLEVPPELSETTAQELVLKEIANTLSQRKKLYAQVSTIEQETS
VLQKTAEERSTAATLLAQGTNMIVSTGSSSSSSTTVCASAVTVQSNKLNSVKNSRRSREH
RARSQEWPEVPEVGKIQESNPEVLAQKIVETCRQIEAGKFQGAAAPSSQVNGKNKAILEV
PPPPPTAPVSIKSSPGHHFKDTTLMPAPKQQQQQQMTLSQLPKCELPGLSASRKQESPKV
ANFEDRLKSIITTALNEDQEQRSKAVEASPSPSPLHSPAPKRSKQHPAGAINPAQSLPNN
LHNIITVSTQGLMHLNANTTISPITPPLPGPCAGATASTAPPPPANLPYGAYGGAVAKTT
VSSKYQSAKEPKYSPVRQAPLPPPPPSHMAALYPAGQQATPADLGYQRRRSSVSATSYEH
YMVQQQQQIQQQQLMLAAAAHAAQRQQMRVEEQQQQHHQQQHHHHPQHRLPQHVQHQHTH
PHPHHPNEFKAPPADSHLQRSSSREQLIAEPPQSQPLELLPRASSANSDYSGYRIRPPSR
PSSNSSQPDYTQVSPAKMALRRHLSQEKLSQHVTPQATPPLPGHGGPPTSGKTIGDLVNG
EIERTLEISHQSIINAAVNMSTSGASFMERAFLNERSNDRLLINLNAQRPERVHVRPLSE
ESQDTQPTSYAQERGPGVGAGGAAAGGNSNLATLAHVAYAQKAQGGGRANAGTAPPATHS
SSARSGRDYQPVALPRAEFKGSIEAYFHEEQQQKQSKGLGSAGASSLRGPRLNGANPPLE
GLAASLQDHVRARKYKEETEERQRRAAAAASSSAGIPPPGMELTTPYAHQAPPAHSYHHH
GASINGTPHKVELGIKRSSPLASHQQPPRPSKLAHYEPPTTQQQHHAHLYANGQVLPPPP
AHDATTPSPTPSSSSSSCGRRSNNNNGKLLVDPPLLMSPEINSLLGDEKPLQLSHHPQQQ
QQMLHHHQSQQQQQQHLQLTQQQLRVAHLGHGLGHGHSTMPTLGGQRNGNAADDVNDLAT
QRTITNYDPRRRLRTTLSGPTKLSAAHSNQNLNGYVLADSSSSCPTVPQ
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atggccacaccccaagtcaaggacttggtgttgcgctcgcccgctggctcctccgatgtc
atttccttcgcctggcccctgcagatcggacatggacaggacaagcacgataatggcatc
gacatcatcgacaccattaagttcgtctgcgatgaactgccatcgatgtcatcggccttc
gaggaaaccaatctccacaaaattgacactgcctgctataagactatgaccggtctggtc
gatcgcttcaacaaggccgtcgacagcatcgttgcattggaaaaaggaacttcactgccc
gccgagcgcctgaacaagttcgctcaccctagccttctaagacacatattgcaattagtt
tacaatgccgccgtacttgatccggacaaactcaaccagtacgagcccttctcgccagag
gtttacggcgagacgagctatgagctggtgcagcagatgcttaagcacgtcactgtcagc
aaagaggacacgttcatcgatctcggctcgggagtgggccaggtggtcctccagatggcc
ggatcctttccgctgaagacttgcatcggcatcgagaaggccgacactccagcgcgatat
gctgaacgcatggacgtcatctttcgccagtatatgggatggtttggaaagcgtttttgc
gaatacaagctgataaagggtgacttcctggtcgatgagcatcgggaaaagatcacctca
tcgacgctggtttttgtaaataacttcgcctttggaccaactgtggaccatcagctcaag
gaacggttcgcagatcttcgcgacggagcacgggtcgtgtcctccaagtcgttttgtccg
ctgaactttcggatcacagatagaaacctcagtgacattggcaccataatgcacgtcagc
gaaattccgccccttaaggggtcagtttcctggacctgcaagcccgtttcgtattatcta
catgtaattgatcgcaccatattggagcgatactttcagcgcctgaaaactaaaggcggc
aacgatcacgagagcgtgggaactgttcgcacgacacgtgatcgcgccaagcgagaggcg
aacgttggccaacaccatcacaacaatcatcatagcaacagcaacaaccacgccaacagc
aacaaccatcagagggagcgggagcagcccaacggagctaccgcttctgccgcccatcag
caacgccatcagtcccagtcgccagctgatgtgagcggcgcgggaatagcagttgcagct
agcgggcaacaagcagcctccaagacacgccagcaactgcagcatcagcataaccagcag
caacgcagcctggacatggagagcagcacagagagcgatggcgaggcgaccaatggcaat
ggtggcaataccaccaccgccaccaataccacctcagcctcaaatggtcctatgactagg
aaagtttggtccgactggtgcagttccaagggcaagagttcgcagtctgacgacgaggag
aacaacaactcgaacagcaacggcggaagtatcggtggtagcattggaggaggatcagtt
ggccggcaggctcgagctgctacccagaagaagcgcaaaaagttgactaggaaagctgcg
atagccagcaaatctgctgccgctgcacaaagggaagcggaggctgcagcagcggcggcg
gcaacggtgccaagcaaggagtccagttccaaagaggatccaccaagagctgctagcgcc
ggacctggtcgcaagggacgcatgaagaagggtgcacgtggcagaaagtccttaaagatt
gttggattggaagctctgcacaagcaaacagtgttgagtacggccttggataccatgacc
aaaaaactgccagcagctcctggaaccgtggatcaacagcttactgctttgctcacggaa
aacatggcacatacagagctggatattccagcggcgccacaagatacgccttatgccttg
cagatccttctagatgtgttccgttcgcagtacacgtcgatgatcgagcacatgaaatca
agtgcctatgtcccccaggttcagaagcagattgcccaagagcaggagaggatggccagg
ctgaaaaacagagccagccagttggacaagcagataaaagtgctgatcgatgacagcgtt
gctctacttaaggtgcgaatgaacgagctaggcatccatgttaattcacccaacgattta
atcgcccaggcaaaggagattgtgggcagacataaggatctacagcacacagcaagtaga
atgcgcaacgaagtaaccttttacgagggcgaacagaagctgctgcttaacaaacaatta
aaaaacctacccgagtatcagaaactctgtggtactgttaatggaaaggtgaagctggag
gtgcccccggaactttcagagaccacggcccaggagctggtgctaaaggagatcgccaac
acgctaagtcaacggaagaaactttacgcccaggtgtccaccattgaacaggagacctcg
gtgttgcagaagacagcagaggaaaggtccaccgcagcgacgcttttggcgcaaggaaca
aatatgattgtgtcaaccggatcatcttcctcctcctccacaactgtgtgtgcaagtgca
gtgacggtgcagagcaacaagttgaactccgtgaagaactctcgacgcagtcgcgagcac
cgagcgcgttcccaggagtggccagaggttcccgaagtgggtaagattcaggaaagcaat
cccgaagtgctggcacagaaaatcgtggagacctgccgccaaatcgaagctggcaagttc
caaggggcagccgcgccctcgtcccaagtgaacggcaagaataaagcaattttagaggtc
ccaccacctccgcccactgcgccagtgagcattaaatcctcacctgggcaccactttaaa
gacaccacattgatgccagcacccaagcaacaacagcaacagcagatgacgctttcccag
cttccgaagtgtgagttgcccggactatcggctagtcgcaagcaggaatctcccaaggtt
gccaactttgaggatcggttaaagagcatcatcaccacggccttaaacgaagatcaggag
cagcgcagtaaggctgtggaggcatcaccctctccctctcctcttcacagtccagcaccc
aagcgatcaaagcagcatccggctggagcgataaatcctgcccagtcgctgcccaacaat
ctgcacaacatcatcaccgtctccacgcagggtctgatgcatcttaatgccaataccaca
atatccccgataactccaccactgccgggtccatgtgcaggagccaccgcatctacagcg
ccgcctccgccagcgaatcttccatatggggcttacggcggggcagtggccaagacaact
gtgtcgagcaagtaccagtcagctaaagaaccgaagtattcgccagttagacaggcacca
ttaccgcctcctccgccctcccacatggctgctttgtatccagctggacagcaggccacg
ccggcggaccttggttaccagaggcgacgcagctctgtaagtgccaccagctatgaacac
tatatggtgcaacagcagcagcaaatccagcaacagcagctcatgttagcagcagctgct
catgctgcccagcgtcaacagatgcgcgtagaggagcaacagcagcaacatcatcagcag
cagcaccaccaccatccgcaacatcgtctgccgcagcatgtgcagcatcagcatacgcat
ccgcatccgcatcatcccaatgagttcaaggcgccgccggctgatagtcatctgcagcga
tcgagcagccgtgagcaattgatagcggagccaccgcaatcgcaaccactcgaactgctg
cctcgggcaagttccgccaactcggattacagcggatatcgcatccgtccgccaagcagg
ccaagctccaactcctcgcaaccggattacacgcaagtttcacccgcaaagatggctctg
cggcggcatctgtcgcaggagaagctaagccaacatgtcacgccccaggcaaccccgccg
ttgccaggtcatggagggccccccacatcaggcaagaccattggcgacttggttaacggg
gaaatcgagcgaacacttgagatttcgcatcagagcatcattaatgcggctgtgaacatg
agcactagtggtgctagcttcatggagcgggccttccttaatgagcggtcaaacgatcgg
ttgctgatcaacttgaatgcccaacgacccgagagggttcatgttcgtccgctctccgag
gaatcccaggatacgcagcccaccagttatgctcaggaaagaggacctggtgtaggtgct
ggcggagcggcagctggaggtaacagcaatctggccactttggcccatgtagcctatgcc
caaaaggcacagggcggcggtcgagccaacgcaggaactgccccacccgcaacccactct
tcttctgctcgttctggacgggattatcagccggtagctctgccccgagcggagtttaag
ggcagcattgaggcctattttcacgaggagcagcagcaaaagcagtcgaaggggttagga
tcagcaggagcgtcatctttgcggggaccgcgtcttaatggtgccaatcctccattggaa
ggcctagcagcatcgctgcaggatcatgtgcgtgccagaaagtacaaggaggagaccgag
gagcgtcaacgacgcgcagcagccgctgcttcgtcttcagcgggaataccgccgccgggc
atggaactgaccacgccctatgcccaccaggctcctccagcccacagctaccaccaccat
ggtgcaagcatcaatgggacaccgcacaaagtagaactgggaataaaacgcagctcaccg
ctggcctcgcatcagcaaccgccacgtccctcgaaattggcccactacgagccgccaacg
acgcagcagcagcatcatgcccacctgtacgccaacggtcaagtgctacctccgcctcca
gctcatgatgcgaccacgccttcgccgacgccctcgtcatcttcatcgtcctgtggtcgt
cgaagcaataacaacaatggaaagctgctcgtggatccacctttgctgatgagtcccgag
atcaattccctgttgggcgacgagaagcctttgcagctgtcgcaccacccacagcagcag
cagcaaatgctgcatcaccatcagtcgcagcaacagcagcagcagcatctgcagctgacc
caacagcaactgcgtgtagcgcatcttggacatggtcttggtcacggtcacagcaccatg
cccactctgggcggacaacgcaatggcaatgccgccgacgatgttaacgatttggcaact
caacgtactataactaattacgatcccagacgtcgccttcgcacgactttgtctggccca
acgaaactatcagctgcccatagtaatcagaatctgaacggatatgttctggccgatagt
agtagtagttgccctacagtaccccaataa

DBGET integrated database retrieval system