KEGG   Drosophila erecta: Dere_GG13537Help
Entry
Dere_GG13537      CDS       T01060                                 

Definition
GG13537 gene product from transcript GG13537-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
der  Drosophila erecta
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dere_GG13537
  Replication and repair
   03420 Nucleotide excision repair
    Dere_GG13537
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dere_GG13537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 499 aa AA seqDB search
MADTKSGTGRYSAAGGSGTTGLSPLVQGPANLECKDFQEYLRTRQTPETLEKLYNYPPIC
LAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAI
PGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLEKDSKPRDIAFLDTYAMSRWRCVLHY
MVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFML
QYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLVFQRKRK
EGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGL
FTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIQSKSCLP
PTVVDQIKLWELERNRFTYTEGVVYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ
KNGHDDVKRYWKKYSKSGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaaatccggtactggtcgttactcggctgccgggggaagtggaaccacc
ggcttgtcgcccttggtgcagggtcctgcgaacttggagtgcaaggattttcaggagtat
ctgcgcactcgccaaacgccagagacgttggagaagctctacaactacccgcccatttgc
ttggccgtatttcgggagcttccagagatagcccggcagtttatcataaggatactgttc
gtggatcaacctgtgccacaggcggtggtcacatcatggggtgcccagcgttgtgccaag
gagcaagccgaggcaaccagctgcctgacggccttgaatgtctggcgagtcacagccatt
ccgggtggtctttctgcatgggagctgtcgcccaccttcaagaaaagcgtgcgccaggtg
ctgctgggcggcggaaagccttggcccatgaccaacacgctggagaaggactcgaagccc
agggacattgctttcctggatacatacgccatgtcccgctggcgctgcgtcctgcactac
atggtcggcaccggaaatcggaatggcaccgatgcggaggccataagcccggacgccgtt
aggattctgctgcacgctaatctcatgaaacgggatgaacgagatggtatcacaatcacc
cggcagggctttcagttcctgctgctggacacgcgagctcaggtgtggcactttatgctc
cagtacctggacacgtgcgaagagagagggatcagcctgccagaatgcttgtccatgttg
ttccagctcagtttttcaactctgggcagggactacagttcggagggcatgaacagtcag
atgctgaccttcctgcagcacctacgggagtttggactggtcttccaacgtaaacgtaag
gaggggcgcttctatcccacacgtttggctctaaatgtgaccagcaaggaggcggctgcg
actgcctctgtggccatggatgaggaggccactcaggactgcggttacatcgtggtggag
acaaactaccgggtgtatgcctacactgattctccgctccaggttgccgtgttgggtctg
ttcacagagcttctctaccgctttcccaatctcgtcgtgggcgtcctaaccagggattca
gtgcgtcaggcgttgcgtggcggtattacggcagagcagattgtctcgtatctggagcag
tatgcgcatcccaatatgcgaatggtcgagtcagccattcagtccaaatcctgcctgccc
cccacagtcgttgatcaaattaagctgtgggaactagagcgaaatcgcttcacctacacc
gaaggcgtggtgtacaatcagttcctctcgcatacagatttcgtaacgctaagagactac
gctcagtcgatccacatgctagtgtggcaaaatgagcgaactcgcacaatggtggtgcaa
aagaatggccacgatgatgtcaagcgttactggaagaagtactctaagagtggtgtttaa

DBGET integrated database retrieval system