KEGG   Drosophila erecta: Dere_GG13817Help
Entry
Dere_GG13817      CDS       T01060                                 

Definition
GG13817 gene product from transcript GG13817-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
der  Drosophila erecta
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dere_GG13817
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG13817
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dere_GG13817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 816 aa AA seqDB search
MSGGPSITLKSQPIDGNNTGNAAAQQQQQGANGAASSGASGAAGNAGAAQNPGHGGTAGG
AGSAPAEGTRQNSLQRIQQRKLKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRH
RDVESSYCPEFNEECRNASCRHSLRSHIAHLDNISSSSMDELLGAIIDMENLFMSMQRVE
DDDTKKVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFEAPCITKAVLSLVFYKYNHLTTPE
LQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQ
FETSLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITQMPKFLETLRAELLKDD
SPIWDPSYRPPNSFVIQQRKRHQEVATVPIGASVASIGGNKRASVGEPLQKRIKKEPTDR
SSSENLDDLPTDVVMHAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGN
SLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFR
PFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQG
FSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRKQSEILKELIAQRHNEV
QKVRPGLTCFKEGLLSIPVESIPGLREIGWKQQIRPARSSRPLEESSDPEKLATSFASVL
QSVRQHTSAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIF
SNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccatccataacgctaaaaagtcaaccaatcgatggtaacaacacgggc
aacgctgcggcgcaacagcagcagcagggagcgaatggcgcagcatcttctggtgcatct
ggagccgctggcaacgctggcgccgcccagaatccaggacacggaggaactgcgggcgga
gcaggcagtgcgccggcggagggtacgcggcagaacagcctgcagcggatccagcagcga
aagctgaaggtcttcaatctgcccgtgccacagaaattggccaaactgtcgatgtattcc
gcctgccagtcggaaggatgccgctgcaccggatggaaaacaccgcaggaaaatcgccac
cgtgacgtggaatcttcctactgtccggagttcaacgaggagtgccgcaacgccagctgt
cggcattcactgaggtcgcacatagcccatctggacaacatatccagttccagcatggac
gagttattgggcgccatcatagacatggagaacctattcatgtccatgcagcgcgtcgag
gacgatgacaccaagaaggtgtacctgtatctcttccgtttgctgcgccagtgcgtcctc
acgcgccagcaggcggtcatccggggtcctctcggtgatccgccatttgaggcgccctgc
atcactaaggctgtgctgtcgctggtcttctacaagtacaatcacctcactacgccggaa
ctccaaaccatgaccgaggtggccaagacgttcttgaactttctgaatcactacaacttt
gaatcgccgtcgacaagaaggggagatctcacccacgaggatgcctctaactacaaaatc
aactacactaggtggttggtcttctgtcacgtgcccgccttttgtaactcccttcgccaa
tttgaaacgtccctagtctttggacgaacgctcctgcgcactgttttccagtgcatgtcg
cagcagctcaagaagaagtgcatctccgagcgggatcgctttcccgaggacaagcgttcg
atcatcacgcagatgcccaagttcctggaaacccttcgcgccgaattgctcaaggatgat
tcgcccatttgggatcccagctaccgcccgccaaattcctttgtcatccagcagagaaag
cgtcatcaggaggtggcaactgtacccattggtgctagtgtagcaagcatcggtggcaat
aagagggccagtgtgggtgaaccgctccaaaagagaatcaaaaaggagcccacagatcga
tcaagcagtgagaacttggatgacctgcccacggatgtagtgatgcacgccatgaaatcg
gtgtcagagtcgaagaccaccaacaaggcggagatactcttcccggtaaatgtgtcgcgc
gatgagaacgtgaaggcggaggagcagaagcgtgccattgagttccatgtggtgggcaat
tcactgactaagccggtggacaagcagactgttttgtggctactgggcctgcagctcgta
tttgcctatcagctacccgagatgccacgcgagtacatcagccagttggtttttgacacc
aagcacaaaaccctggcgctcatcaaggaaaaccagcccattggcggcatctgtttccgc
ccattcccgtcgcagggtttcaccgagatcgttttttgtgcggtcaccatgtcggaacaa
gtgaagggctatggaacgcacttgatgaaccacttgaaggattacagcatacagagaggc
atcaagcatctgctcacattcgccgattgcgatgccatcgggtacttcaagaaacagggt
ttctccaaggatatcaagttggcgcgaccagtttatgcgggctatatcaaggagtacgat
agtgccactctgatgcactgcgagttacatccaagcattgtgaacacacagttcatagct
gtgattcgcaaacagagcgagattctgaaggagctaatcgcccaacgccacaacgaggtg
cagaaagtcaggcccggcttgacttgcttcaaggaaggcctgctctccattcccgtggaa
tcgattcctggcctgcgagagatcggttggaagcagcaaattcgcccggcacggtcatcg
cgacccctcgaggaatcctccgatccagagaagctggccacgtcctttgcatctgtgctg
cagtccgtgcgccaacacaccagcgcctggcccttcctgcgcccggtgaccgctgcggaa
gttccggactactacgatcatatcaagtacccgatggacctgaagaccatgggagaacgc
ctgaagaagggatactaccaaacgcgccgcctgttcatggcggacatggcccgcatcttc
tccaactgtcggttctacaactcgcccgacactgagtattatcggtgtgccaactccctg
gagcgctacttccagaccaaaatgcgcgagctgggcctgtgggacaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system