KEGG   Drosophila erecta: Dere_GG13906Help
Entry
Dere_GG13906      CDS       T01060                                 

Definition
GG13906 gene product from transcript GG13906-RA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG13906
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   Dere_GG13906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 659 aa AA seqDB search
MTIKPVSAPPSAKRVAGNVDPDNKEAQVVVVEQSVVSQTHNHAHNHRNVVIDGQSPQRRG
EVYDELARTHRCSPHKSTRSKRRDHHEAHAHLYKRDRLEREKLVHPTAAAGSGAPGVTGS
KCNSPPLASTSGSSSPSAVGRNSPEHLGLGCTTVPTAQVQMSPATAAANLLKTVEETFSG
YNSGDEHLQPKERLIPVEEWQRRDLEFAKCMEQRGYELKPVEEDGACLFRSISLQIYGDE
EMHDVIRQHTMDYIHENREYFGQFVTEDINSYIQRKRARDAHGNHIEIQAISEIYSRTVE
VYCYQSNPINIFNSEQSQAGYPPLRLSYQRGSHYNAILDPYNATVGVGLGLAGYKPEIQT
KEAARLSEQLEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRENMQRSRSSNTAA
GSATSSTVTSAEALTDSDASPSKYSVCGGTGSSGNTPVTLTSGSGGDGTGPAFSLSPKTL
SQFSHKLPPEVNELGGYDSDATDMSSTSSVGHCGGSSSPSTAASQRSGKGSKSQRRTTAL
RKKRRHETREAPLASKSAEALEAPLRKSPKRDSAPSVARANTPEAEQRPSTSKQSSYSPQ
KSGDGQSPREQSYSSFYQELLEASYANEGANESEMLQQAIQMSTRDYMEDQKRKFLCGP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaagccagtgagcgcaccaccgagcgcgaaacgcgtggctggaaatgtggat
cccgataacaaggaggcccaggtggttgtggtggagcagtcggtggtcagccagacccat
aaccatgcccacaaccaccgcaacgtcgtcatagatgggcagagcccccagaggcgtggc
gaggtctacgacgaactggcacgcacccatcgctgcagcccacacaagagcacacgctcg
aagcgtcgagatcaccacgaagctcatgcacacctctataaacgcgatcgtcttgagcgc
gagaaactagtccatccgacggcagcggcgggcagcggagcacctggtgtaactggcagc
aaatgcaacagtccaccgttggcttcaacttctggcagtagcagtccgtcggcggttggc
agaaactcacccgaacacttgggactgggttgcaccacggtgcccacagctcaggtccag
atgtctccggctacggcggcagccaatttgctaaaaacggtggaggaaaccttttccggt
tacaatagcggcgatgagcaccttcagcccaaagagcgattgattccagtggaagagtgg
cagcgacgcgacctggagttcgccaagtgtatggaacagcgcggctacgaacttaagcct
gtcgaggaggatggcgcctgcctgtttcgctccatatcccttcaaatatacggcgacgag
gagatgcacgacgtgatccgccagcacactatggattacattcacgagaatcgggaatat
tttggtcagttcgtcaccgaggacatcaatagctatatacagcgtaaacgagctcgtgat
gcccatggcaaccacattgagatccaggctatttccgagatctacagtcgtaccgtcgag
gtatactgctaccagtcaaatcccatcaatatatttaactcggaacagtcgcaggcaggc
tatcctccgctgcggttatcctatcagcgcggatcccactacaatgctattttggatccc
tacaacgccaccgttggcgtgggcctgggcttggctggatacaagcccgagatccaaacc
aaagaggctgcgcgtctcagcgagcagttggagatcgaacaaaccatgtttgaagataaa
ctaaagacaacagactgggaggccactaacgaagccattgaggagcaaattgcacgcgag
tcctacctacagtggtgccgcgagaatatgcaacgctcgcgcagcagcaatacggcggca
ggatcagccacatcctcaacggttacctctgcagaagcgcttaccgattcagatgcctcg
ccctcaaaatactctgtttgtgggggcaccggcagcagcggtaatacacctgtgacattg
accagcggtagtggtggtgatggcacaggccccgccttttcgctgtcccctaaaacactt
agtcagtttagtcacaagctgccgcctgaggtgaacgagctgggtggctacgatagcgat
gctacagacatgagtagtaccagctcggtgggacactgcggaggcagctcatcaccgagc
acagctgcaagccaacgttccggcaagggatccaagtcacagcgtcgcactacagcgctt
agaaagaagcgacgacacgaaactcgcgaggcgcctttggctagcaagagcgccgaggct
ctggaggctccgctgaggaagagtccaaagcgcgattcagcgccatcagtggcacgagct
aacacgccagaggctgagcagcgtccctccacctcgaagcagtcgtcttattcgccacag
aagagcggggatggccagtcacctagggagcagagctactccagcttttaccaggagctg
ctcgaggcatcctacgccaatgaaggcgccaacgagagcgaaatgctgcagcaagccatc
cagatgtccacacgcgattacatggaggaccaaaaacgaaagtttctttgcggaccgtag

DBGET integrated database retrieval system