KEGG   Drosophila erecta: Dere_GG13968Help
Entry
Dere_GG13968      CDS       T01060                                 

Definition
GG13968 gene product from transcript GG13968-RA
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 761 aa AA seqDB search
MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIKNWDEHNHNVQDLYCESKVWQA
KPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETV
LHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELE
EAAPGTSSTAIKTETSAKPKTGDDDGEVDVDADDESPKKLEKTDSKVDPTVVEKKEKEEP
EETEDADVKPAVEDVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQ
ECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKTF
ADPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNG
LTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCR
QVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCD
HPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDL
CQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEI
ISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGD
HRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcacaaaagtgccgcccgagtggaagaggcgtgtcaagtcggaatatatcaaa
atcaggcagcagaagcgctacaagcgcgccgacgagatcaaggaggcgtggataaagaac
tgggacgagcacaaccacaatgtacaggacctgtactgcgagtcgaaggtttggcaggct
aaaccctacgatccgccgcatgtggactgcgtgaagcgggcggaggtgaccagctacaat
ggcattcccagcggtccacaaaaggtgcccatctgcgtgatcaatgctgtcacccccata
cccaccatgtacacgtgggcgccaacgcagcagaacttcatggtggaggatgagacggtg
ctgcacaatataccctatatgggcgacgaggtcctcgataaggatggcaagttcatagaa
gagctgatcaaaaactacgatggcaaggtgcacggcgacaaggatccctcgttcatggac
gatgccatctttgtggaactggtgcacgccctcatgcgctcctatagcaaggaactggag
gaagccgctccgggtacgtcatcgacggccattaaaacagagacatctgcgaaacccaaa
acgggcgatgatgatggggaagtggatgtggatgcagatgatgaatctcccaagaaactg
gagaaaaccgacagcaaagtggatccgactgtggttgagaagaaggaaaaggaggagccg
gaggagactgaagatgctgatgttaagcccgctgtggaggatgtcaaggacaagctgccc
ttccctgcccccattatttttcaggccatcagcgccaactttccagacaagggcactgcg
caagagctcaaagaaaagtacattgagctgacggagcatcaggatccggagcgcccccag
gagtgcacacccaacattgatggcatcaaggccgagagcgtttcccgggagaggactatg
cattcctttcacacgctcttctgccggcgttgcttcaaatacgactgcttcctgcaccgc
ttgcaaggacatgcgggccccaatctgcagaagcggcgctacccggaactgaagaccttc
gcggatccctgcagtaactcctgctacatgttgatcgatggcatgaaggaaaagctggcg
gctgatagcaaaacaccgcccattgattcctgcaatgaggcgagctccgaggacagtaat
gacagcaacagtcagttcagcaacaaggactttaaccatgagaatagcaaggataatggc
ctgacagtgaatagtgccgctgtggctgagatcaactccattatggctggcatgatgaac
atcaccagcacgcagtgcgtttggactggtgctgaccaagcactttatagggttttgcat
aaagtttacttgaagaactactgtgcgattgcacacaacatgctcaccaagacctgccgc
caggtgtacgagtttgcccagaaggaggacgccgagtttagcttcgaggatttgcgacag
gactttacacctccgcgcaagaagaagaagaagcaacgcctgtggtcactgcattgccgt
aagattcagctgaagaaggactcatcctcgaatcacgtgtacaattacacaccctgcgac
catccaggccatccctgcgacatgaactgctcctgcattcagacgcaaaacttctgcgag
aagttctgcaactgcagcagcgattgccaaaatcgtttccccggctgccgctgcaaggct
cagtgcaacacgaagcagtgtccttgctacctggcggtgcgcgagtgcgatcccgatctc
tgccaggcctgcggagcggatcagtttaagctgaccaagatcacgtgcaagaacgtgtgt
gtgcagcggggactgcacaaacacctgctcatggctccctctgacatcgccggctggggc
atctttcttaaggagggtgcgcaaaagaacgagttcatttcggaatattgtggcgagata
atatcccaagatgaagctgatcggcgtggcaaagtgtacgacaagtacatgtgctcgttc
cttttcaacctgaacaacgactttgttgtggatgccactcgaaagggcaacaagattcgg
ttcgccaatcattccatcaatcccaactgctatgccaaggtgatgatggtcaccggcgac
catcgcatagggatctttgccaagcgggccattcagcccggcgaggagctcttctttgac
tatagatacggacccacagagcagctgaagttcgtgggtatcgagcgtgaaatggaaata
gtttaa

DBGET integrated database retrieval system