KEGG   Drosophila erecta: Dere_GG14044Help
Entry
Dere_GG14044      CDS       T01060                                 

Definition
(RefSeq) GG14044 gene product from transcript GG14044-RA
  KO
K03259  
translation initiation factor 4E
Organism
der  Drosophila erecta
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dere_GG14044
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dere_GG14044
Messenger RNA biogenesis [BR:der03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dere_GG14044
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dere_GG14044
Translation factors [BR:der03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dere_GG14044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 250 aa AA seqDB search
MVVLETEKTSAPSSEQGRPEPPTSAAAPAKAEAKDIKPKEDAQEAGEPAANTANTNAPAG
DDAVRTEHLFKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEI
KVGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKTSKSDLDNLWLDVLLCLIGEAFDHSD
QICGAVVNIRGKNNKISIWTANGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQ
GSNVKSIYTL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttggagacggagaagaccagcgcccccagtagtgagcagggtcgtccggaa
ccacccacttcggccgcagcgcccgccaaggccgaggctaaggatatcaagcccaaggag
gacgcccaggaggctggtgaaccagcagcaaacactgcaaacaccaacgctcccgccggc
gacgatgctgtgcgcaccgagcacctgttcaaacacccgctcatgaacgtctggacgctg
tggtaccttgaaaacgatcggtccaagtcctgggaggacatgcaaaacgagatcaccagc
ttcgataccgtcgaggacttctggagcctttacaatcacatcaagcccccatcagagatc
aaggtgggcagtgactactcgctgttcaagaaaaacattcgtccgatgtgggaagatgca
gccaacaaacagggcggtcgttgggttattacccttaacaaaacctccaagagcgatctg
gataacctatggctagatgtgctgttgtgcctgattggcgaggccttcgatcactccgat
cagatctgcggggctgttgtaaacattcgcggcaagaacaacaagatatccatctggact
gccaacggaaacaacgaggaggctgcccttgagattggtcacaagctgcgcgatgcactg
cgtctgggacgcaacaattcgctgcagtatcagttgcacaaggacacgatggtcaagcag
ggctcgaacgtgaaatcaatctacactttgtag

DBGET integrated database retrieval system