KEGG   Drosophila erecta: Dere_GG14051Help
Entry
Dere_GG14051      CDS       T01060                                 

Definition
GG14051 gene product from transcript GG14051-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
der  Drosophila erecta
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dere_GG14051
   00052 Galactose metabolism
    Dere_GG14051
   00500 Starch and sucrose metabolism
    Dere_GG14051
   00520 Amino sugar and nucleotide sugar metabolism
    Dere_GG14051
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dere_GG14051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEQARQPALKAEMDR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVR
KYKGFRVQIHTFNQSCFPRISREHYLPVAKDFEIEKDMEAWYPPGHGDFYDTFRNSGLLK
KFIQEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLI
QMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNN
KTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggccaccagcgagcaccctccgactca
aaggagttccacgaggtgaccaaacgggatgctctgcgtctgctggagcacgatgtggac
cgtctgctggagaccactgagcaggcccgccagcctgccctcaaggcagaaatggatcga
ttcgccgatctgtttggacgcttcattcaggaagagggtcccgcattggactggaacaaa
attcagaagctgcctgagaatgctgtgatgaactactcgaatctcaagtcgcccaaaaac
gagcagaatgagatccgcaacatgttggataaattggtggtcatcaagctgaacggtggt
ttgggcacctcaatgggttgccatggacccaagagtgtgattcccgtgcgttcggacctt
accttcctggatctgaccgtgcagcaaatcgagcacctcaacaagacctacgatgctaat
gtgccgctggtactgatgaactccttcaacaccgacgaggacaccgagaagatcgtgcgc
aagtacaagggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatc
agtcgcgagcactacctgccggtggccaaagacttcgaaatcgaaaaggacatggaggcc
tggtatccccctggacacggtgacttctacgataccttccgcaactctggcctgctgaag
aagttcatccaggagggccgcgagtactgcttcttgtccaacattgataacctgggcgcc
accgtcgatctgaacatcctcaacaagctggtgggcgaggagcgggccaccactcctgtg
gagtttgtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcatt
caaatggaaaacaagctgcgtctgctggaaattgcccaagttcccccggagcacgtggat
gacttcaagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctg
gcagcaattgatcgcgttttgcgtgaacgtaccttaaacatggaaattattgtgaacaac
aagacgctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatg
aagtgctttgatggcgccatcggcatcaatgtgccccgttcccgtttcttgcccgtgaag
aagtcttcagatctgctgctggtcatgtcaaatttatatacccttaagaacggcagcctg
gtaatgtcgccacagcgaatgtttcctaccacgccactcgtcaagctgggtgagaaccac
ttctcgaaggtgaaggagttcctcggtcgcttcgccaacatcccggatatcattgagctg
gatcacttgaccgtgagtggagatgtgactttcggtcgtggcgtttcattgcgcggtact
gtgatcatcattgccaaccatggcgatcgtatcgatatcccagctggtgccattctagag
aacaagatcgtatctggcaatatgcgtatcttggaccactaa

DBGET integrated database retrieval system