KEGG   Drosophila erecta: Dere_GG14051Help
Entry
Dere_GG14051      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
der  Drosophila erecta
Pathway
der00040  Pentose and glucuronate interconversions
der00052  Galactose metabolism
der00500  Starch and sucrose metabolism
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Module
der_M00361  Nucleotide sugar biosynthesis, eukaryotes
der_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dere_GG14051
   00052 Galactose metabolism
    Dere_GG14051
   00500 Starch and sucrose metabolism
    Dere_GG14051
   00520 Amino sugar and nucleotide sugar metabolism
    Dere_GG14051
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dere_GG14051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6545457
NCBI-ProteinID: XP_001972140
FlyBase: FBgn0106313
UniProt: B3NCD6
Position
Unknown
AA seq 513 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEQARQPALKAEMDR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVR
KYKGFRVQIHTFNQSCFPRISREHYLPVAKDFEIEKDMEAWYPPGHGDFYDTFRNSGLLK
KFIQEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLI
QMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNN
KTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggccaccagcgagcaccctccgactca
aaggagttccacgaggtgaccaaacgggatgctctgcgtctgctggagcacgatgtggac
cgtctgctggagaccactgagcaggcccgccagcctgccctcaaggcagaaatggatcga
ttcgccgatctgtttggacgcttcattcaggaagagggtcccgcattggactggaacaaa
attcagaagctgcctgagaatgctgtgatgaactactcgaatctcaagtcgcccaaaaac
gagcagaatgagatccgcaacatgttggataaattggtggtcatcaagctgaacggtggt
ttgggcacctcaatgggttgccatggacccaagagtgtgattcccgtgcgttcggacctt
accttcctggatctgaccgtgcagcaaatcgagcacctcaacaagacctacgatgctaat
gtgccgctggtactgatgaactccttcaacaccgacgaggacaccgagaagatcgtgcgc
aagtacaagggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatc
agtcgcgagcactacctgccggtggccaaagacttcgaaatcgaaaaggacatggaggcc
tggtatccccctggacacggtgacttctacgataccttccgcaactctggcctgctgaag
aagttcatccaggagggccgcgagtactgcttcttgtccaacattgataacctgggcgcc
accgtcgatctgaacatcctcaacaagctggtgggcgaggagcgggccaccactcctgtg
gagtttgtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcatt
caaatggaaaacaagctgcgtctgctggaaattgcccaagttcccccggagcacgtggat
gacttcaagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctg
gcagcaattgatcgcgttttgcgtgaacgtaccttaaacatggaaattattgtgaacaac
aagacgctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatg
aagtgctttgatggcgccatcggcatcaatgtgccccgttcccgtttcttgcccgtgaag
aagtcttcagatctgctgctggtcatgtcaaatttatatacccttaagaacggcagcctg
gtaatgtcgccacagcgaatgtttcctaccacgccactcgtcaagctgggtgagaaccac
ttctcgaaggtgaaggagttcctcggtcgcttcgccaacatcccggatatcattgagctg
gatcacttgaccgtgagtggagatgtgactttcggtcgtggcgtttcattgcgcggtact
gtgatcatcattgccaaccatggcgatcgtatcgatatcccagctggtgccattctagag
aacaagatcgtatctggcaatatgcgtatcttggaccactaa

DBGET integrated database retrieval system