KEGG   Drosophila erecta: Dere_GG14461Help
Entry
Dere_GG14461      CDS       T01060                                 

Definition
GG14461 gene product from transcript GG14461-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dere_GG14461
   04068 FoxO signaling pathway
    Dere_GG14461
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dere_GG14461
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dere_GG14461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 430 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAGAAANGSCAAVHQSTECCLQEFRHSTVAHPS
ELPPSPHQWE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcactggtacagggtggtgctgccggtggtgcgccacagggcgcc
agcgcaatcttggccgcagcggctccctactatcagccgccggccgttccccaggatgtc
cagccggatcgtcccatcggctatggagcattcggagttgtctgggccgtcacagatccg
cgggatggacgacgcgtggccttgaagaagctgccaaatgtgttccaatcgctggtctca
tcgaagcgcgttttccgcgagctgaaaatgctgtgcttcttcaagcatgagaatgttctt
tcagctctggacattctacagccaccgcatttggatttctttcaagaaatctatgtgata
acggagctgctgcaatcggatctgcacaagataatcgtgtcgccgcagcacctgtccgcc
gaccacatcaaggtgttcctctaccagatcctgcgcggcctcaagtatctgcactcggca
cgcatcctgcatcgcgacatcaagccgggcaatctgctggtcaactcgaattgtgtgctc
aagatctgtgacttcggattggcccgcgtcgaggagccggatcaggccaagcacatgacc
caggaggtggtcacccagtactatcgcgcaccggagattctgatgggcgcacgccactac
tcgtcggcggtggatgtgtggtcggtgggctgcatcttcggcgagctcttgggccgtcgc
atcctcttccaggcacagaaccccgtgcagcagctggagctgatcaccgagctgctgggc
acgcccaccatggaggacatgcggcacgcctgcgagggcgcccgcactcacatgttgcgc
cgggcgcccaagccgccctcattctcggtgctctacacactcagctcacatgccacgcac
gaggcggtgcacctgctctgccagatgctcgtcttcgatccggacaagcgcatctccgtg
acagatgccctggcgcatccgtatctggatgagggacgtctgcgttaccactcgtgcatg
tgcaagtgctgcttcactacctcagccggaatgcgtcagtacacggctgattttgagccc
tccgccggccagcccttcgatgatctgtgggagcgcaagctgacatccgtgcagcaggtc
aaagaggagatgcacaagttcattgccggagcagctgcaaacgggtcgtgtgccgctgtg
catcaatccacagagtgctgccttcaagagtttcgccattcgactgtggcacatccttcg
gagcttccgccctcgcctcatcaatgggaatga

DBGET integrated database retrieval system