KEGG   Drosophila erecta: Dere_GG14479Help
Entry
Dere_GG14479      CDS       T01060                                 

Definition
GG14479 gene product from transcript GG14479-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG14479
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG14479
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG14479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 828 aa AA seqDB search
MEELRKHLSKVNVPCASGAGSPPIYKDECVYSYDNPETPTGLYVCLHSFLGFGEAYVREY
ADKTGNRVFLHIQRVKTPKEGTDTEAECDPESEAGPERKITRLAIGVEGGYNESDMAKKY
EIKDTYSIVVAPQLDKKLPYPDPELPMRVTQAVEAILAADSAIAKLEKATLMGTWDGEVR
QASKYAENLQQLDNGKKIPPSGWQCEKCDLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAV
EHYRVTGFPLAVKLGTITADGKSDVFSYPEDDMVLDPHLERHLSHFGINMAAMKKSEKSM
VELELDINQRIGEWSALTESESELQPLAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQQR
FVGTGAEHYFREFPSDPANDFNIQMAKLGTGLHSGKYSSIAENTLDTDHSTGISPAMFKN
IVGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQTNPADALKFLLEDRVECLASRKVKY
KTREEYSFRLPIPLDKATNLDEVREFLEREKAARETGQRLVDRDIVRHKVPLQACLERFF
GPELIEQFYSTAIDGKTNARKITRLATMPDCLMIHVGKFTLGDDWVPKKLDVSVDMPDEL
DLSNWRSAGGLQPGEEALPEPAAEEVKFAFDEAVMSELLTMGFPPEACKRACYHTKNSGL
EAASNWLMEHIADEDISEPFVVPSNSIGDSAANQFVANPESLAMLMSMGFDERQAVAALK
ATDGNVERATDWIFSHADSIGVEEVAPASNSSAAAASSAPNKTDYRDGGGKYRLMAFISH
MGTSAQVGHYVCHIRKKGEWVIFNDSKVAKSQNPPKDLGYLYLYMREQ
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggaggaactacgcaagcatttatccaaggtgaacgtgccctgcgcatccggcgcggga
agtcctccgatctacaaggacgagtgcgtctattcctacgacaatcccgagacgcccacc
ggtttgtacgtgtgcctgcacagctttttgggtttcggcgaggcgtacgtgcgtgagtac
gccgacaagaccggcaaccgagtcttcctgcacatccagcgggtgaagacgccaaaggag
ggcaccgatacggaggctgaatgcgatccggagtcggaggctgggccggaacggaagatc
actcgcctggccatcggcgtcgagggtggctacaacgagtcggacatggccaagaagtac
gagatcaaggacacgtacagcatcgtggtggcgccccagctggataagaagctaccctat
ccggatccggagctgcccatgcgtgtcacccaggcggtggaggcgatcctggccgccgac
tcggcaattgccaagctggagaaggccacgctgatgggcacttgggatggtgaagtgcgt
caggcttcgaaatacgcagagaacctgcagcagctggacaatggcaagaagattccccca
tccggctggcagtgcgagaagtgtgatttgaccaacaacctctggcttaatctgaccgat
ggttcgatcatgtgcggtcgcaagttctttgacggcagtggaggcaacgatcacgccgtg
gagcactacagagtaacgggattcccgctggcagtgaaactgggcactatcaccgctgat
ggcaagtcggatgttttctcctacccggaggacgacatggtacttgatccccacctagag
cgccacctctcccactttggcatcaacatggcggcgatgaagaagagcgagaagtccatg
gtggagcttgaattggatattaaccagcggatcggcgagtggtcggcgcttacagagagc
gaaagtgagctgcagcctcttgccggtcctggatacactggcatgcgcaacctgggcaac
tcctgctacatcaacagcgtgatgcaggtgctcttcgtcatcccagacttccagcagcga
ttcgtgggcaccggagcggaacactatttcagggagttccccagcgacccggccaacgat
ttcaacattcaaatggccaagctaggaactggcctgcattcgggaaagtacagcagtatc
gccgagaacactctggacaccgatcacagcaccggaatttcgccggccatgtttaagaac
attgtgggcaagaaccaccctgatttcagcaccaaacaacagcaggatgccaacgatttc
tatttgcatttgctcaccctgctggacaggaattcacggaaccaaacaaatcccgcagat
gctctaaagttcctgctggaggatcgcgttgagtgtctcgctagccgcaaggtgaagtac
aagactcgcgaggaatacagtttccgtctgcctattccgttggataaggccaccaatctg
gatgaggttcgggagttcctggagcgtgagaaggctgcccgagagaccggacaacggctt
gtggatcgcgatatcgtgaggcacaaggttcctctacaggcctgcctggaacgcttcttc
ggcccggagctgatcgaacaattctactccactgccattgatggcaagacgaatgccagg
aaaatcacgcgattggccaccatgcccgactgcctgatgattcacgtgggaaagttcacg
ctgggcgacgactgggttcccaagaaactggacgtttccgtagacatgcccgatgaactg
gatctaagcaactggcgctccgctggtggcctgcagcctggtgaggaggctcttcctgag
cccgccgcagaggaggtgaagtttgcatttgacgaggcggtcatgtccgagttgctgacc
atgggctttccgccggaggcctgcaagcgtgcctgctaccacacgaaaaacagcggattg
gaggcagcctccaactggttgatggagcacatcgccgacgaggatatctcggagccattt
gtggtgccgagcaacagcattggagacagcgcagccaaccagtttgtggccaatcccgag
agcctggccatgctcatgagcatgggctttgacgaacgacaggcggtggctgcgctgaag
gcgaccgatggcaacgtggagcgcgccaccgactggatcttctcgcatgccgattctatt
ggtgttgaggaagttgcccccgcttcgaattcatcagctgcagcggcttcctcggcgccc
aataagaccgactaccgcgatggaggtggcaagtaccgtctgatggcattcatctctcac
atgggcacctccgcccaggtggggcactacgtctgtcacattcgcaagaagggtgaatgg
gtgattttcaacgacagcaaggtggccaagtcacagaacccgcccaaggacctcggctat
ctgtatctctacatgcgcgagcagtag

DBGET integrated database retrieval system