KEGG   Drosophila erecta: Dere_GG14509Help
Entry
Dere_GG14509      CDS       T01060                                 

Definition
GG14509 gene product from transcript GG14509-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 695 aa AA seqDB search
MTKVTEGGISHGVQDVGKSNLEFPILAKAFVRQDSVHDFISSDSDADFIALSGSKSNVVT
LELNSKFMVVDPWPYFVAILDSNAAETRPLDVLANKVNLVAIYDSCDVLESQQLALDPAY
TAVCSVAVPPARLICVKRAPKPMANGNLLLGSLNTYGSLSLINKPAEYSRWNPLEGLNIA
ETLRDTLLPEVNIAKIKDFKNYQEYINPAWITMFAWLPDDSSTTGQHVLVLGTASGSLWL
LTISADVKTLLSHQETKTSLGRICHIQAFKDLLLVGDSNGLIHLYQLPEKGSKAPVLVKP
LWEKADRMGLQMAVITECPIKECYYITCCKAAHLLTWSMPRTGNTECLKARIYVGGMKIT
GLCSLGNSSYAAGTSGSYLHRVQIIHENNQLSLQMQSIAMGVLQDFQVMGLNSSRHKNLM
TLFLYRNKEYMSESVSQKNQLLMQVLKVGNQDPLAQLISHLKSNNPMNHYTDLLAELRLH
VFAEENWQRYMDYGPLDSFQFTDSATESQLQQLQIKFHVLQYVLRLQSSHLQLTVHIQKS
QDELQLLLAMLNITHIRLRLNFIGSFSKRTPFQEQATKCLLEEAHRLMNKVKANFTDKHA
LGSTANAFVQQVGNHIQLLHKNLGIPVIANPQEKLVHRCSVSFVEISPSLERRYCSLCDR
QILFEMENLRELYESGRYLNCPVCHGSFAAEMLNA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagttactgagggaggcatttcacatggcgttcaagatgtggggaaatctaac
ctggaatttcccatcctagccaaagcattcgtccgccaggactcggtgcacgactttata
agcagcgactccgacgcagactttattgcactgagcggctccaaatcgaatgtggttacc
ctggagttgaacagcaagttcatggtcgtggatccctggccctattttgtggccatcttg
gattctaacgctgcggaaacacgacccctagacgtattggccaacaaagtgaatttggtg
gccatatacgacagctgcgatgtcctggaatcacagcagctggccctggacccggcatac
accgctgtgtgctccgttgccgtgccaccagccagattaatatgtgttaagcgagcaccc
aagccgatggctaatggaaatctcctgctgggctcccttaacacttatggatccttgagc
ctaataaacaaaccggcagaatacagtcgctggaaccctttggaaggactcaatatcgct
gaaactctgagggacactctgctgcctgaagtgaacatcgccaagatcaaagactttaag
aactatcaggaatatattaatcccgcctggatcactatgtttgcttggttacctgatgat
tcaagtaccactggccagcatgttttggttttgggaaccgcctccggaagtttgtggttg
ctcacaataagcgccgacgtcaaaactcttttgagtcaccaagaaacgaaaaccagcctg
ggtcgtatctgccatatacaagcattcaaggaccttctactggtgggcgatagcaacgga
ctcatccacctgtaccaattgccagaaaagggaagcaaagctcccgtcttagtgaagccc
ttgtgggagaaagcggatcgaatgggtctgcaaatggcagtgatcactgaatgccccatc
aaggagtgctattatataacctgctgcaaggcggcgcatctgctgacctggagcatgcca
agaacggggaacacagagtgtctgaaggcgcggatctatgtcggcggaatgaagatcacc
ggtctttgcagcctgggcaacagtagctatgctgcaggaacctcaggaagctatctgcat
cgcgtacaaattattcacgagaataatcagctcagcttgcagatgcaatcaatagccatg
ggtgtgcttcaggactttcaggtgatgggactgaacagcagcagacacaagaacttaatg
acccttttcctctaccgcaacaaagaatacatgagtgaaagtgtgtctcagaagaatcag
ttgcttatgcaagtgctcaaggtggggaatcaggatccacttgctcagcttatcagtcac
ctaaaatccaataaccccatgaatcactataccgatttattagctgaacttcgtctacac
gtatttgccgaggagaattggcaaaggtatatggactatggtccattagattcctttcaa
tttacggattccgccactgaaagccagctgcagcagcttcaaatcaaattccacgtcctt
caatacgtgcttcgcctgcaatcgagccacctccagctgactgttcacatccaaaagtcc
caggatgaactgcagctactcctcgcaatgctgaatatcacacatataagactgaggctc
aacttcattgggtcgtttagtaagaggacaccattccaggagcaggcaacaaaatgtttg
ttggaggaggcccaccgactgatgaataaagttaaggccaacttcacggacaagcatgcc
ctaggttctacagcaaacgcattcgtccagcaagtaggcaatcatattcagctcttgcat
aagaatctgggtattcctgtgatagctaatccccaggagaagctagttcatcgctgcagt
gtgtcctttgtggagatctcccccagcttggagcgacgctactgcagcctctgcgaccgc
cagatacttttcgagatggaaaacctacgagagctctacgaatccggaagatatctgaat
tgccctgtttgccatggaagcttcgccgcggaaatgttaaatgcataa

DBGET integrated database retrieval system