KEGG   Drosophila erecta: Dere_GG14680Help
Entry
Dere_GG14680      CDS       T01060                                 

Definition
GG14680 gene product from transcript GG14680-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
der  Drosophila erecta
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dere_GG14680
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dere_GG14680
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG14680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 538 aa AA seqDB search
MDSPTTETTPPPPTLSGPFVGAIDEGTTSARFIIFRAGTDEIVCFHQIEVESIFQKEGWC
EQDPMAIVNTVNECIAGACKKLVAVGGKVEEIITIGITNQRESTVVWDKNSGQPLVNAII
WLDNRTTSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPAVSQAMEK
GTAMFGTIDTWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTIL
PEICSSAEFYGSIAQGVLQGIGITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTG
PSIVHSTHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRDNINLIQNSGQIETMAS
TVDNSLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDS
MHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVESR
YQMEAPLSKSGPREAIKPSISATDRNLRYQKWKMAIDRSLNWETSTLPQGERDAFDGA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggactctcccacaactgagacgaccccgcctccacctacactatctggtccattcgtt
ggggctattgacgagggaaccacctcagcgcgatttataatatttcgtgcgggcactgac
gaaattgtgtgcttccatcagattgaagtggagtcaatttttcaaaaggagggatggtgc
gaacaggatcccatggccatagtaaacacggtcaacgagtgcatcgctggagcctgcaag
aaacttgtggccgtgggcgggaaggttgaggaaataatcacgattggaataacaaaccaa
cgcgagtccacagtcgtctgggataaaaactccggccaaccgctagtcaacgctatcatc
tggctagataatcggactaccagcacggtggaggagcttttggaaactattccgaacaat
gccagaaacatcaactacctgcgcccattgtgcggacttcctctgtctccgtacttttca
ggagtgaaactccgctggctgcgagacaacgtgccggctgtcagccaggctatggaaaag
ggaacggccatgtttggcaccatcgacacctggctgatgtataatcttacgggtgggaag
gactgtggtgtccacaagacggacgtgaccaacgcttcgcgcactatgctcatgaatatc
gaaacccttcagtgggacgccaacttgctcaagttttttgggctgcccaagaccattttg
ccggagatctgctcgagcgcggagttctatggcagcattgcgcagggcgtgctgcagggc
ataggcataacatcggttttgggcgaccagcaagccgctctagtaggtcaacaatgtctg
gccaaaggtcaggcgaaagccacttatggcactggatgttttctgctttataacacagga
ccgtcaattgttcactcaacgcacggtttgctaacgactgttggctaccaactaggacgg
aaagcagtcccattttacgctcttgagggcagcgtgtctattgccggtgctgcattcaac
tggttgcgcgacaacataaatcttattcaaaactcggggcaaatagaaaccatggctagc
actgtggacaactctcttgacgtatactttgtgccagcttttaatggactctacgccccc
tactggaatcaggacgcacgtggtgttatttgtggactgagtgaggaaacaacaagtgag
cacatagtacgagccaccctggaagcagtttgtttccaggtccgtgatatcctcgattcg
atgcacaaggactgcaagataccactggccaagctaatggtggacgggggcatgactgtg
aataatctgttcctgcagcttcagtccgacctagtagggattcaagtacttcgggcgaag
atcgcagagacaacagcgctgggagctgcaatggcagcctacaaagccgttgaaagccga
taccaaatggaggctccactctcaaaatctggtcccagagaagccattaagccatcgatt
agtgccaccgatcgcaacctgcgctatcaaaagtggaaaatggctatcgatcgatcactg
aactgggagacttcgacacttccacagggcgagcgggatgccttcgatggagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system