KEGG   Drosophila erecta: Dere_GG14819Help
Entry
Dere_GG14819      CDS       T01060                                 

Definition
GG14819 gene product from transcript GG14819-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
der  Drosophila erecta
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dere_GG14819
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dere_GG14819
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG14819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 576 aa AA seqDB search
MTEGKNLPHSSADVPFRSKELRKQSLIQHSGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFSASDIVTVGITNQRETTIVW
DAVTGKPLYNALLWKDIRTSTTVEHIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNV
PEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFG
IREEMLPTIHSCSEVFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDS
RDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICF
QTRDILECMHQECGYEINKLHADGKLTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMC
AAQADGINLCQFEPEKRYYENVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKT
REYTEENYRMMSSLPASIFLISSFAMLVHSLAASGQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcaagaacttaccccactccagtgcggatgtgccgttccgcagcaaggag
ctgcgcaagcagtcgctcatacagcacagcggcctggtcggagtcatcgatgagggcacc
aagaccatcggcttctccatctacaccacgccggacttcaaggagatcgccgcgcaccgg
gtggagctgagcgtgatcacgccccaggatggctggtacgagcaggacccgctggagatg
atggcctcgatcaacaagtgcgccgaggaggccatcaagcagttgcccgaacagggcttc
tccgccagcgacatcgtcaccgtgggcataaccaaccagcgcgagacgacgatcgtctgg
gatgcggtcaccggcaaaccgctctacaatgcgctcctgtggaaggacatccgcaccagc
actacagtggagcacatcgtggcgaaggtgcaggatccgaaccactttcgcagcagcacg
ggactgcccatctccacgtacttctcggccctcaagatccgctggctgcgggacaatgtt
cccgaggtgcggcaggccatccgggaaaggcgttgcaaggcgggcacagtggacagctgg
atcgtctggaacttgacaaacggagctctccacatcacggatgtgacgaacgcctcccgc
actctgctcatgaatctggagacgcaagcctgggatcccgttctgctcaagacgttcggc
atcagggaggagatgctgcccaccatccacagctgttcggaggtatttggcaagatcact
tcggagcgaagtccgctgcgtggaatgaccctgagtggaataatgggcaaccagcaggcc
tcgcttctcggccagatgtgcgtgaagccgggtcagacgaagaacacttaccggtccgga
tgctttctgctctgcaataccggggacaagcccgtattctctaggcacgggctgctcacc
accgtggcttacaagctcggtccccaggcaccgacgatctacgccattgagggagccgtg
tcggtggctggacatgcgctctcctggctgcaaaacaaggtgcgtatcctgccggactcc
agagatgccgagaaatatgcggagatggtgcccacatcgggtgatgtgtacttcgtgccc
gccttcacaggactatatgcaccctactggcggcagaatgctcgcggcatcatcattggg
ctcacgcagttcacccgtaagaatcacattgtgagagctgcactggagagtatctgcttc
caaacgcgcgacatcctggagtgcatgcaccaggagtgcggctacgagatcaacaagctc
catgcagatggcaagctcaccacgaacaacctgttgatgcaactccaggcggacaccatt
ggtatgcccgtcttccgctcccagctaatggactctacggccttcggggcagccatgtgc
gccgcccaagcagatggtatcaacctctgccagttcgagcccgagaagcggtactacgag
aacgtgcactacgacacgttcctggccaccaccacggatgtagagcgcaaggagcgttac
ggcaagtggaagcgggcggtggagcgcagcctgggatgggtcatcaagcagaagaagacg
cgggagtacacggaggagaactaccgcatgatgtcctcgctgccagcgagcatcttcctc
atcagcagcttcgccatgctggtgcactccctcgctgcgagtggtcagtaa

DBGET integrated database retrieval system