KEGG   Drosophila erecta: Dere_GG14987Help
Entry
Dere_GG14987      CDS       T01060                                 

Definition
GG14987 gene product from transcript GG14987-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
der  Drosophila erecta
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:der04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 903 aa AA seqDB search
MMIQEPVQAAIWHCLNYYNFKDAVFLAERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKALRSPQCRYLQAKCAYELKKYAEAESVLISTGFADAKNCDELQRDFGDLACFAYQLM
AQICVRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAATIFQIHSTDVFNTCQG
SSANANAIVLFGAEQQSQQHQERQSLITNLSNSNYILTTPVDQQQQNQQQVQQINQNQNH
NSNMVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGYPQDTAGQHQQNQQLY
DMSSGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNITYSPMPQML
VEVNQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMNVP
PNPNAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKTKSRMTKICLNNELIEEK
SHHLSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQSAD
GLMALLRDLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAV
AIFESIHKAEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWCVAGNCFSL
QKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFEKAMDYFRAAVVRDPRHYNAWY
GIGTIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAATLD
PKNPLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLALMH
FSWATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGSYD
SDY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcactgcctgaattactacaacttc
aaggatgctgttttcctggcggagcgactgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgctccaatcaggtgcaccaggcatactggctgctc
aaagagaaggcactacgctcgccacagtgtcgctatctacaggccaaatgcgcctacgag
ctgaagaaatacgccgaagcggagagcgttctgatctctacgggattcgcggacgccaag
aactgcgatgaactgcagcgggacttcggggatctggcctgcttcgcctatcagttaatg
gcccagatatgcgtgagaaccgagcgcaacaaactggccgtcagtgctttaaggcgggcc
ctcaagctgaacccattcatgtggcacgccttcgctgatctgtgcctgctgggccaggac
acagatgcggcgaccatattccagatccacagcacagatgtgttcaacacctgccaaggc
agcagcgccaatgccaatgcaatagtgctgttcggcgccgagcagcaaagtcaacagcat
caggagcgccagtcgctgatcaccaacctaagcaactccaactacattctgaccacgccc
gttgatcagcaacaacagaatcagcagcaggtgcagcagatcaaccagaatcagaaccac
aacagcaacatggtgacgcccatcaacaataataataataacaacaatctcaatagctcg
atcagcatgctgcgcggcggtttggtgcaaaactccagcatgctggcgatgctggaggac
acacctatgggatatccgcaggacacagccggtcagcatcagcagaaccagcagctctac
gacatgagcagcggcacacccttccgcaagcagttcaaatacctttcagccatctcaccg
ccaactccgagctttggcatcatgccactgactagtccctgcaccggcaacgatggctcc
ttcattggcaaccacacgcccgttatgaatattacctattcgccgatgccgcagatgctg
gtcgaggtcaatcaggagccgaagatgatgggcaaaaagcttaagacacatgtgggcgga
ctcatcaatcgcaaggagggcagccttaacaaacccgccgtctttacgcaagccggtaac
ataacgccccgcaccccaaacaacaataatgtgggcaacaatggcaatatgaatgtgccg
cccaatccgaatgctgcagtgcgccgcagttcgcggctgttcagcaactcgtattcggtg
aaggagaacaataaatcgcccaacatagccaacaagtttgtgcagccacgttcgccgccc
cgcaaaaccaagtcacggatgaccaagatctgcctgaataacgaactgatcgaggagaag
tcccaccacctgtccgagaagcgcaaggagaaggtggagactattacttcctcgggagcg
aataataacagcggtggccgcagtgccgccgaggaggccaaggtactgttgaacaatagc
ttaaacaacgcccagacgatggcccaccagctaatgggcctcaagaaacagtcggccgat
gggctgatggcccttctgcgggatttggctgaagcctatcagctgctttccaacttccag
tgcaaggcggccataaagcagctagagacgacgataccaaagcaccacctgaactccagc
tgggtgcagtcgctcatcggactggccaggtacgagatgcgcgagtatgaggcggcggtg
gcgatatttgaaagcatccacaaggcagagccatgtcgcttggactacatggagatatac
tcgtcatctctgtggcatctgcagcgtgaagtggagctgtctgctctcgcccaggatctg
attaaccaggacaaaactagcccggtgacctggtgtgtggccggaaattgcttctccctg
caaaaggagcacgaaacagcgattaagttctttaaacgggctgtccaagtggatccagac
tttgtctacagctacacactgctggggcatgagctcgtactcaccgaagaatttgaaaag
gccatggactacttccgggccgcagtggttagagatccacggcattacaacgcttggtac
ggcatcggcaccatatactccaagcaggagaagtatgagctggctgaaattcactacgtg
aaggcactgaaaatcaatccgcagaactcggtgatcctcgtccacatcggcgccatgcaa
ttctacatgaagaagaaggatctgtcgctgcagaccctaaacacggccgccacgctggac
cccaagaacccgcttacgcgattccatcgcggttccatctacttctctttgggcaagtac
caggaggcgttgcgcgaactggaggagcttaaggaagtcgtgcccaaggagtcggtggtg
ttctatctgatcggcaaaattcacaagacgctcggcaacatggatctggcgctgatgcac
ttcagctgggccaccgacctggatcccaagggtgccaacaatcaaatcaaagatgccttc
gactccatggcccatcccagctgctgtccggccaacactacggccctggacgttgatctg
gagccaacttcggagcgttccgatgactccacgcaggcgcagcaggacggaagctacgac
agcgactactag

DBGET integrated database retrieval system