KEGG   Drosophila erecta: Dere_GG15026Help
Entry
Dere_GG15026      CDS       T01060                                 

Definition
GG15026 gene product from transcript GG15026-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
der  Drosophila erecta
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dere_GG15026
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dere_GG15026
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG15026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 522 aa AA seqDB search
MFRLLHALLIAIVLVAHPAWSAPECGRTPEECKEHRMHPDMPEPERHGKAFRVIDGEETS
SYWRQQGVEFIQQKLASQPNRRRAKNVILFLGDGMGVTTTSAARNLLGGEEKSLSFENFP
FTGLSKTYSVDKIVPDSACTATAYLCGVKGQEGTIGVNGQVPRTDCKVMLDESTHVDSIA
KWAMEAGKWAGLVTTTRVTHASPSGVYAHIAERDWENDAEVTSDCGAGSGINDIAYQLAR
GEVGSKLKVIMGGGRKHFVDSSLESWGKRTDGLNLIDEFKSASEKNVYVTTAEELAAVDV
TKTDRLLGLFNDDHLQYFMETTVESSQPTLEQMTRKAIEYMSQNDQGYFLFIEGGRIDQA
HHINQARMALNETIEFSKAIAAAQELTNEDDTLLVVTADHSHVFTYAGYSYRGSDVFGKT
PANGHDGKPYMVLSYANGPSYENFYDAETMERKDPTTVVKGAHDDEFPSGVPIDMDSHGG
DDVPVYALGPWAHLFTGVYEQSTIPHMMAYASCLGEGHTMCK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcctgctgcacgcactactgatcgccatcgtgctggtagctcatcccgcttgg
tcggctccggaatgcggccgaactccggaggagtgcaaggagcacaggatgcatccggat
atgccggaaccggaacgacatggcaaggcattccgggtgattgatggcgaggagaccagc
tcctactggcgccagcagggagtggagtttatccaacagaagttggcttctcagccgaat
aggcgccgggccaagaacgtgatcctcttcctcggcgatggtatgggtgtgaccaccacg
tcagcggctcgcaatctcctgggcggcgaggagaagtccctctccttcgagaacttcccg
ttcacgggcctctcgaagacatattccgtggataagattgtccccgactccgcctgcacg
gccactgcctacttgtgtggcgtgaaaggtcaggagggaaccatcggcgtgaatggccag
gtgccccgcaccgactgcaaggtcatgctggacgagagcactcacgtcgactccatagcc
aagtgggccatggaggcgggcaagtgggcgggtctggtgaccaccacccgcgtcactcac
gcctcgccctctggagtgtatgcccatatcgccgaacgcgactgggaaaacgacgcggag
gtgactagcgactgtggagcaggctccggaatcaatgacattgcctaccaactggcccgc
ggcgaggtgggcagcaagctcaaggttatcatgggcggcggacggaagcactttgtggac
tccagccttgaatcctggggcaagcgtaccgatggactaaacctcatcgatgaatttaaa
tccgccagcgaaaagaatgtctatgtgaccaccgccgaagagctggctgccgtggatgtc
accaaaaccgatcgcctcctgggtctcttcaacgacgatcacctgcagtacttcatggag
accacagtggagagcagccagcccactttggagcagatgacccgcaaggccatcgagtac
atgagccagaacgaccagggctacttcctcttcatcgagggaggtcgcatcgaccaggcc
caccacatcaaccaggcgcgaatggctctgaacgaaaccatcgagttctccaaggccatc
gctgccgcccaggaactgactaacgaggatgacaccttgctagtggtcaccgccgaccac
tcacatgtgttcacctacgcgggatactcgtaccgtggatcggatgtatttggaaagacc
cctgcgaatggacacgatggcaagccatacatggtgctgagctacgccaacggaccgagc
tacgagaacttctacgacgcggagacgatggagcgcaaggatcctaccacggtggtgaag
ggagcccacgacgatgagtttccctcgggagtgcccatcgacatggactcccacggaggc
gacgatgtgcccgtctacgccttgggtccctgggcgcacctgttcaccggagtttacgag
cagagcacgattccgcacatgatggcctacgcatcctgtttgggcgagggtcacaccatg
tgcaagtag

DBGET integrated database retrieval system