KEGG   Drosophila erecta: Dere_GG15132Help
Entry
Dere_GG15132      CDS       T01060                                 

Definition
GG15132 gene product from transcript GG15132-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
der  Drosophila erecta
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:der00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:der00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MAGRSIAHFFLGSVAIALGSYIYLTMQMSLRQFQNISRQALRCYSMRRNLGPVLELSQGQ
RQCLRLCTVLLPVSCAATPSSAASSAAQHSTAAAIDMSANGDYKNAASIYEFTVKDTHGN
DISLEKYKGKVVLVVNIASKCGLTKNNYQKLTDLKEKYGERGLVILNFPCNQFGSQMPEA
DGEAMVCHLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNK
EGVPINRYAPTTDPMDISKDIEKLL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctggccgttccatcgcccacttttttctgggttccgtggcaatcgccctgggatca
tacatctacttaaccatgcaaatgagtctcaggcagtttcagaacatttcccgccaggcc
ctcaggtgctactcgatgaggcggaacctgggccccgttctcgagctgagtcagggtcag
aggcagtgcctccgcctctgcaccgtcctgcttcccgtgagctgtgcggccacgccctct
tccgccgcctcctcagccgcccagcactccacagcagctgccatcgatatgtctgctaac
ggagattacaagaacgccgcctcgatctacgagttcaccgtgaaggacacccatggcaac
gatatctcgctggaaaagtacaagggcaaggtggtcctggtggtgaacatcgcctccaag
tgcggcctgaccaagaacaactaccagaagctgacggatctgaaggagaagtacggcgag
cgcggcctggtgatcctcaacttcccctgcaatcagttcggatcccagatgccggaggct
gacggagaggccatggtgtgccacctgcgcgactccaaggctgacatcggcgaggtgttt
gccaaggtcgatgtgaatggagacaatgctgcgccgctgtacaagtacctgaaggccaag
cagaccggcaccctaggcagcggaatcaagtggaacttcaccaagttcctggtgaacaag
gagggcgttcccatcaaccgatatgccccgaccaccgatcccatggacatctccaaggac
atcgagaagctgctgtag

DBGET integrated database retrieval system