KEGG   Drosophila erecta: Dere_GG15450Help
Entry
Dere_GG15450      CDS       T01060                                 

Definition
GG15450 gene product from transcript GG15450-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
der  Drosophila erecta
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dere_GG15450
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dere_GG15450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MISFLFIVNRALSSSSSVSSSAASLTRSKNKMSAPGPRPLVLCGPSGSGKSTLLKRLFAE
FPNTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAA
VREIQAQGRVCILDIEQKGVEQIRRTDLHPILIFNNPPSIKELERRLRQRGSETEESLAK
RLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQEKQGVSVSLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagcgttagcagc
agtgcggcgtccttaacaagaagcaagaacaagatgagcgcccccggaccacgccccctc
gtcttatgcggaccctcgggctccgggaaaagtacactgctaaaaaggctgttcgccgaa
ttccccaacacctttggcttcagcatatcgcacaccacgcggaagccacgcgagggcgag
gagcacggggtgcactactactttgtggaacggccggaaatggaggcagccatcgccggc
gacgagttcatcgagacggccgagtttacgggcaatctgtatggcacgagcaaggcggcg
gttagggagatacaggcgcaggggcgagtctgcatactggacatcgaacagaagggtgtg
gagcagatacgtcgcacggatctccatcccatactgatcttcaacaatccgccgagcatc
aaggagctggaacggcgactacgccagcgtggctccgaaacggaggagtcgctggccaag
cggctcaatgccgcccaggtggaactcgactatggcctgacgccgggcaactttcacaag
atcatcaacaacgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtccag
gagctcaaggagcaggagaagcagggagtatcagttagcctgaagtaa

DBGET integrated database retrieval system