KEGG   Drosophila erecta: Dere_GG15450Help
Entry
Dere_GG15450      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
der  Drosophila erecta
Pathway
der00230  Purine metabolism
der01100  Metabolic pathways
Module
der_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dere_GG15450
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dere_GG15450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 AAA_18 MMR_HSR1 ABC_tran RsgA_GTPase AAA_29 RNA_helicase Mg_chelatase ATPase_2 AAA_21 AAA_5 NACHT AAA_28 G-alpha cobW AAA_14 Pox_A32 AAA_17 Rad17 AAA_24 Med25_VWA AAA Roc Septin HGTP_anticodon2 NTPase_1 AAA_30 MobB AFG1_ATPase AAA_23
Motif
Other DBs
NCBI-GeneID: 6543546
NCBI-ProteinID: XP_001972299
FlyBase: FBgn0107701
UniProt: B3NCM8
Position
Unknown
AA seq 235 aa AA seqDB search
MISFLFIVNRALSSSSSVSSSAASLTRSKNKMSAPGPRPLVLCGPSGSGKSTLLKRLFAE
FPNTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAA
VREIQAQGRVCILDIEQKGVEQIRRTDLHPILIFNNPPSIKELERRLRQRGSETEESLAK
RLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQEKQGVSVSLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagcgttagcagc
agtgcggcgtccttaacaagaagcaagaacaagatgagcgcccccggaccacgccccctc
gtcttatgcggaccctcgggctccgggaaaagtacactgctaaaaaggctgttcgccgaa
ttccccaacacctttggcttcagcatatcgcacaccacgcggaagccacgcgagggcgag
gagcacggggtgcactactactttgtggaacggccggaaatggaggcagccatcgccggc
gacgagttcatcgagacggccgagtttacgggcaatctgtatggcacgagcaaggcggcg
gttagggagatacaggcgcaggggcgagtctgcatactggacatcgaacagaagggtgtg
gagcagatacgtcgcacggatctccatcccatactgatcttcaacaatccgccgagcatc
aaggagctggaacggcgactacgccagcgtggctccgaaacggaggagtcgctggccaag
cggctcaatgccgcccaggtggaactcgactatggcctgacgccgggcaactttcacaag
atcatcaacaacgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtccag
gagctcaaggagcaggagaagcagggagtatcagttagcctgaagtaa

DBGET integrated database retrieval system