KEGG   Drosophila erecta: Dere_GG15517Help
Entry
Dere_GG15517      CDS       T01060                                 

Definition
GG15517 gene product from transcript GG15517-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
der  Drosophila erecta
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dere_GG15517
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dere_GG15517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MAAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQSARDNVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYNGLSHSSSDDEMDDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccggtcattgtcgaggccacggccaagcaaaccgccacgctgatcttcatg
cacggcctgggtgatacgggtcacggatggagcagcgccctagccgccatccgcccacct
ttcatgaaagtcatctgccccacggcgcccacacagcccgtttcgctgaacgccggcttc
cggatgccatcgtggttcgacctgaagacactggacatcggtgggcccgaggacgagcca
ggcatccagtcggcgcgcgataatgtgcacggtatgattcagaaggagatcagtgctggg
attccggccaatcgcattgtcctgggcggattctcgcagggaggagccttggcattgtat
tcggcactcacgtacgaccagccgctggccggcgtggtggccctgtcctgctggctgccg
ctgcacaagcagttcccaggcgccaaggtgaacagcgatgatgtgccaattttccaggcg
catggcgactacgatcccgtggtgccgtacaagttcggccagctgagcgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacgtacaatggactatcgcactcgtcgtcc
gacgacgagatggatgacgtcaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system