KEGG   Drosophila erecta: Dere_GG15517Help
Entry
Dere_GG15517      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
der  Drosophila erecta
Pathway
der00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dere_GG15517
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dere_GG15517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_6 FSH1 DLH Abhydrolase_1 Abhydrolase_3 Peptidase_S9 DUF2974 Cutinase Lipase_3 Esterase
Motif
Other DBs
NCBI-GeneID: 6544729
NCBI-ProteinID: XP_001972413
FlyBase: FBgn0107765
UniProt: B3NGY2
Position
Unknown
AA seq 232 aa AA seqDB search
MAAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQSARDNVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYNGLSHSSSDDEMDDVKDIISKWTQWDSQNMARKAQCCQLS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccggtcattgtcgaggccacggccaagcaaaccgccacgctgatcttcatg
cacggcctgggtgatacgggtcacggatggagcagcgccctagccgccatccgcccacct
ttcatgaaagtcatctgccccacggcgcccacacagcccgtttcgctgaacgccggcttc
cggatgccatcgtggttcgacctgaagacactggacatcggtgggcccgaggacgagcca
ggcatccagtcggcgcgcgataatgtgcacggtatgattcagaaggagatcagtgctggg
attccggccaatcgcattgtcctgggcggattctcgcagggaggagccttggcattgtat
tcggcactcacgtacgaccagccgctggccggcgtggtggccctgtcctgctggctgccg
ctgcacaagcagttcccaggcgccaaggtgaacagcgatgatgtgccaattttccaggcg
catggcgactacgatcccgtggtgccgtacaagttcggccagctgagcgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacgtacaatggactatcgcactcgtcgtcc
gacgacgagatggatgacgtcaaggacataatcagtaaatggacacagtgggatagccag
aacatggctagaaaggcgcaatgctgccagttatcgtag

DBGET integrated database retrieval system